Recombinant Staphylococcus aureus UPF0365 protein NWMN_1476 (NWMN_1476)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Staphylococcus aureus UPF0365 Protein NWMN_1476

The Recombinant Staphylococcus aureus UPF0365 protein NWMN_1476 (Uniprot ID: A6QHB6) is a partial or full-length recombinant protein derived from S. aureus strain Newman or other clinical isolates. It belongs to the UPF0365 family, annotated as a Flotillin-like protein (FloA), potentially involved in membrane organization or bacterial pathogenesis .

Production and Purification

The protein is synthesized using recombinant DNA technology, with variations in host systems and purification methods:

Production Systems

Host SystemProduct CodeProtein LengthTagPuritySource
BaculovirusCSB-BP408335FLG1PartialUndetermined>85%
E. coliRFL20553SFFull-length (1–329)His>90%
E. coliMBS7064928PartialUndetermined>90%

Purification Notes:

  • Lyophilized or liquid forms are available, with storage recommendations at -20°C/-80°C .

  • Reconstitution in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol is advised for long-term stability .

Comparative Analysis of UPF0365 Family Proteins

ProteinFunctionRelevance to S. aureus
NWMN_1476Hypothetical membrane organizationLimited data
Flotillin-1 (Mammalian)Membrane raft formationAnalogous structural role

Applications in Research

This recombinant protein is primarily used in:

  • Structural Studies: Elucidating interactions with host cells or bacterial virulence factors.

  • Vaccine Development: Potential use as an antigen in S. aureus vaccine candidates (though not explicitly tested in literature).

  • Immune Response Modulation: Investigating mechanisms akin to those of SpA or Hla .

Research Gaps and Future Directions

  1. Functional Characterization: Limited data on NWMN_1476’s role in pathogenesis; requires knockout studies or interaction mapping.

  2. Clinical Relevance: No direct association with S. aureus diseases (e.g., bacteremia, pneumonia) has been established .

  3. Therapeutic Targeting: Potential as a biomarker or drug target warrants exploration, given the success of anti-Hla antibodies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; NWMN_1476; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Staphylococcus aureus (strain Newman)
Target Names
NWMN_1476
Target Protein Sequence
MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a significant role in regulating membrane fluidity.

Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What is Recombinant Staphylococcus aureus UPF0365 protein NWMN_1476?

Recombinant Full Length Staphylococcus aureus UPF0365 protein NWMN_1476 (UniProt ID: A6QHB6) is a 329-amino acid protein that belongs to the UPF0365 protein family. It is commonly expressed in E. coli with an N-terminal His tag for purification purposes. While initially classified as a protein of unknown function, bioinformatic analyses suggest it may have biological significance in bacterial physiology .

What expression systems are recommended for producing recombinant NWMN_1476?

Multiple expression systems have been successfully employed for the recombinant production of NWMN_1476, each with distinct advantages:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliCost-effective, rapid growth, high yieldPotential issues with protein folding, lack of post-translational modifications>10 mg/L culture
BaculovirusBetter protein folding, post-translational modificationsHigher cost, longer production timeVariable, typically 5-20 mg/L
Mammalian cellsNative-like post-translational modificationsHighest cost, complex media requirementsLower yield, 1-5 mg/L

E. coli remains the most commonly used system due to its cost-effectiveness and established protocols for Staphylococcal proteins . When expressing in E. coli, codon optimization may be necessary to enhance expression efficiency.

What purification protocol is most effective for recombinant NWMN_1476?

A multi-step purification strategy is recommended for obtaining high-purity NWMN_1476:

  • Immobilized Metal Affinity Chromatography (IMAC): For His-tagged NWMN_1476, IMAC should be performed with a Ni-NTA column using imidazole gradients (10-250 mM) for elution .

  • Ion Exchange Chromatography: Cation exchange chromatography (using SP-Sepharose) is effective as a second purification step, typically with a NaCl gradient (0-500 mM) .

  • Size Exclusion Chromatography: As a final polishing step to remove aggregates and achieve >95% purity.

For enhanced purity:

  • Include 5-10% glycerol in all buffers to improve protein stability

  • Add reducing agents (1-5 mM DTT or β-mercaptoethanol) if the protein contains cysteines

  • Consider using protease inhibitors during early purification steps

How can I optimize soluble expression of NWMN_1476?

To maximize soluble expression of NWMN_1476, consider implementing these evidence-based strategies:

  • Temperature optimization: Lower induction temperature (16-18°C) significantly increases soluble protein yield by slowing protein synthesis and improving folding .

  • Induction parameters: Use lower IPTG concentrations (0.1-0.5 mM) and extend expression time (18-30 hours) .

  • Media composition: Enriched media such as Terrific Broth with glycerol supplementation enhances yield compared to standard LB media .

  • Co-expression with chaperones: Co-expressing with folding chaperones (GroEL/GroES, DnaK/DnaJ) can improve solubility of challenging proteins.

  • Fusion tags: Beyond His-tag, consider testing solubility enhancing tags such as SUMO, MBP, or Thioredoxin if expression yield is insufficient .

A side-by-side comparison of expression conditions in a small-scale format is recommended before scale-up to identify optimal parameters for your specific construct.

What is known about the structure of UPF0365 family proteins?

While no direct structural information is available specifically for NWMN_1476, structural insights can be inferred from related proteins in the UPF0365 family. The most relevant structural information comes from studies of NP_344798.1, a protein from Streptococcus pneumoniae that belongs to a similar protein family (PF06042) .

Key structural features revealed by NMR studies include:

  • An α/β-topology with seven β-strands and seven α-helices

  • Two 3₁₀-helices

  • A strongly twisted antiparallel β-sheet formed by strands β1-β5

  • A smaller parallel β-sheet formed by strands β6 and β7

  • Structural similarity to the catalytic head domain of class II CCA-adding enzymes (DALI Z-score > 9)

These structural characteristics suggest a potential role in nucleotide metabolism or transfer, consistent with bioinformatic analyses that place UPF0365 family proteins within the nucleotidyltransferase (NTase)-fold superfamily .

What techniques are recommended for studying protein-protein interactions of NWMN_1476?

Based on successful approaches used for similar proteins, the following techniques are recommended for investigating protein-protein interactions involving NWMN_1476:

TechniqueAdvantagesLimitationsSpecial Considerations
Co-immunoprecipitationIdentifies endogenous interactionsAntibody specificity criticalUse nuclease treatment to distinguish DNA-mediated interactions
Pull-down assaysWorks with recombinant proteinMay identify non-physiological interactionsInclude appropriate controls for His-tag artifacts
Crosslinking coupled with LC-MS/MSCaptures transient interactionsComplex data analysisOptimize crosslinking conditions for membrane proteins
Proximity labeling (BioID, APEX)In vivo labeling, works with membrane proteinsRequires genetic modificationConsider the orientation of the fusion
Surface Plasmon ResonanceQuantitative binding dataRequires purified componentsImmobilization strategy important for membrane proteins

For membrane-associated proteins like NWMN_1476, it's particularly important to maintain native lipid environments during interaction studies. Significant interactions could be missed or artifacts introduced when using harsh detergents during cell lysis . Nuclease treatment during sample preparation can help distinguish between direct protein-protein interactions and those mediated by nucleic acids .

How can I investigate the potential functional role of NWMN_1476?

A comprehensive approach to uncovering the functional role of NWMN_1476 should involve multiple complementary techniques:

  • Comparative genomics analysis: Identify conserved genomic context and co-occurrence patterns across bacterial species to suggest functional associations.

  • Gene knockout/knockdown studies: Generate deletion mutants in S. aureus to observe phenotypic changes, particularly focusing on:

    • Growth under various stress conditions

    • Membrane integrity

    • Antibiotic susceptibility

    • Virulence in infection models

  • Transcriptomic analysis: Compare wild-type and knockout strains to identify differentially expressed genes, which may reveal pathways affected.

  • Metabolomic profiling: Identify changes in metabolite levels that may indicate biochemical pathways involving NWMN_1476.

  • Protein localization studies: Use fluorescently tagged constructs to determine subcellular localization, which can provide functional clues.

  • Proteomics approach: Identify interaction partners through techniques like BioID or AP-MS, as described in proteome-wide studies of S. aureus .

Since NWMN_1476 has been identified in membrane fractions in proteomic studies , special attention should be paid to its potential role in membrane processes, cell wall synthesis, or transport functions.

What are the optimal storage conditions for maintaining NWMN_1476 stability?

Storage conditions significantly impact the stability and activity of recombinant NWMN_1476. Based on empirical data, the following recommendations should be followed:

For lyophilized protein:

  • Store at -20°C/-80°C for up to 12 months

  • Keep in desiccated containers to prevent moisture exposure

  • Avoid repeated freeze-thaw cycles

For reconstituted protein:

  • Store at -80°C with 50% glycerol for long-term storage (6 months)

  • For working aliquots, store at 4°C for up to one week

  • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0

When recovering from frozen storage, thaw samples on ice and centrifuge briefly before opening to bring contents to the bottom of the vial. The addition of reducing agents may be necessary if the protein contains disulfide bonds.

How should I troubleshoot low expression or solubility issues with NWMN_1476?

When encountering low expression or solubility issues with NWMN_1476, methodically address these challenges using the following framework:

  • Verify construct design:

    • Confirm sequence correctness

    • Check for rare codons in the expression host

    • Evaluate signal sequence or tag interference

  • Optimize expression conditions:

    • Test multiple temperatures (37°C, 30°C, 25°C, 18°C)

    • Vary IPTG concentrations (0.1 mM to 1 mM)

    • Try different media formulations (LB, TB, 2xYT)

    • Adjust induction timing (early, mid, or late log phase)

  • Address solubility issues:

    • Include solubilizing additives (5-10% glycerol, 0.1% Triton X-100)

    • Test different lysis buffers with varying salt concentrations

    • Consider mild detergents for membrane-associated proteins

    • Evaluate refolding from inclusion bodies if necessary

  • Purification troubleshooting:

    • Optimize imidazole concentrations to reduce non-specific binding

    • Test various pH conditions for ion exchange chromatography

    • Consider on-column refolding for difficult proteins

    • Evaluate protein stability with thermal shift assays to optimize buffer conditions

For membrane-associated proteins like NWMN_1476, specialized approaches such as adding mild detergents (0.1% DDM or LDAO) during purification may significantly improve yield .

How can proteomics approaches help elucidate the function of NWMN_1476?

Proteomics offers powerful approaches to investigate the function of uncharacterized proteins like NWMN_1476. Based on successful studies with similar proteins, consider these advanced strategies:

  • Quantitative interactome analysis: Use SILAC or iTRAQ-based approaches to identify interaction partners under different growth conditions. This has successfully identified novel functions for hypothetical proteins in S. aureus .

  • Proximity-dependent labeling: BioID or TurboID fusions can identify proximal proteins in the native cellular environment, which is particularly valuable for membrane-associated proteins.

  • Comparative proteomics: Compare wild-type and knockout strains under various stress conditions to identify pathways affected by NWMN_1476 deletion. A previous study using iTRAQ-coupled LC-MS/MS identified 488 proteins from 5970 distinct peptides in the S. aureus exoproteome .

  • Post-translational modification analysis: Investigate whether NWMN_1476 undergoes phosphorylation, glycosylation or other modifications that may regulate its function.

  • Secretome analysis: Since UPF0365 has been detected in membrane fractions , analyze secreted proteins in knockout versus wild-type strains to determine if it affects protein secretion pathways.

When analyzing complex proteomic data, employ statistical cutoffs similar to those used in previous S. aureus studies (iTRAQ fold-ratio >1.2 and <0.8 with p<0.05) to determine significant differences .

What computational approaches can predict the function of NWMN_1476?

Modern computational approaches can provide valuable insights into the potential function of uncharacterized proteins like NWMN_1476:

  • Structure prediction and analysis:

    • AlphaFold or RoseTTAFold can generate high-confidence structural models

    • Structure-based function prediction tools (ProFunc, COFACTOR) can identify potential binding sites and functional motifs

    • Structural comparison with the NP_344798.1 protein, which has similar fold architecture

  • Network-based approaches:

    • Construct protein-protein interaction networks incorporating known S. aureus interactions

    • Apply guilt-by-association principles to infer function from network neighbors

    • Use biological pathway enrichment analysis of predicted interactors

  • Evolutionary analysis:

    • Phylogenetic profiling to identify co-evolving genes

    • Analysis of selection pressure to identify functionally important residues

    • Genomic context analysis to identify operons or co-regulated genes

  • Machine learning models:

    • Feature-based function prediction using sequence, structure and interaction data

    • Deep learning approaches trained on multiple data types

    • Text mining of scientific literature to identify potential functional relationships

These computational predictions should be used to generate testable hypotheses for experimental validation rather than as definitive functional assignments.

What is the potential role of NWMN_1476 in Staphylococcus aureus pathogenicity?

While direct evidence linking NWMN_1476 to pathogenicity is limited, several lines of investigation suggest potential involvement in virulence mechanisms:

  • Surface and membrane association: Proteomic studies have identified NWMN_1476 in membrane fractions , suggesting potential involvement in host-pathogen interactions or environmental sensing.

  • Expression during infection: Analyze expression patterns during different phases of infection using transcriptomic data from in vivo infection models.

  • Contribution to stress resistance: Test whether NWMN_1476 deletion affects survival under conditions mimicking the host environment:

    • Oxidative stress

    • Antimicrobial peptides

    • Nutrient limitation

    • pH fluctuations

  • Role in biofilm formation: Compare biofilm formation capabilities between wild-type and knockout strains, as biofilms contribute significantly to S. aureus persistence during infection.

  • Impact on virulence factor expression: Determine if NWMN_1476 affects the expression of known virulence factors through transcriptomic or proteomic comparisons of wild-type and knockout strains.

Research on other hypothetical proteins in S. aureus has revealed unexpected roles in virulence, suggesting that comprehensive phenotypic characterization of NWMN_1476 mutants in infection models could yield valuable insights into its potential contribution to pathogenicity.

What are the best practices for presenting experimental data related to NWMN_1476?

When presenting research data for NWMN_1476 or any recombinant protein study, follow these evidence-based guidelines to ensure clarity and scientific rigor:

  • Select appropriate data presentation formats:

Data TypeBest Presentation FormatConsiderations
Purification resultsSDS-PAGE gel images with laddersInclude purity percentage based on densitometry
Protein-protein interactionsNetwork diagrams or heat mapsShow statistical significance of interactions
Structural dataRibbon diagrams with key residues highlightedInclude multiple views of important domains
Functional assaysBar graphs with error barsAlways include appropriate statistical tests
Expression optimizationLine graphs or response surface plotsShow interaction between multiple variables
  • Follow sound data presentation principles:

    • Keep it simple and avoid redundancy across text, tables, and figures

    • Present general findings before specific details

    • Ensure all data directly answers the research questions

    • Use past tense when describing results

    • Include all controls and technical replicates

  • For tabular data:

    • Create clear titles that summarize variables

    • Present similar data in columns for easier comparison

    • Include footnotes to explain abbreviations or statistical methods

    • Avoid repeating identical information across text, tables and figures

  • For proteomics data:

    • Follow established reporting guidelines for MS-based experiments

    • Include false discovery rates and confidence intervals

    • Present identification scores above established thresholds (e.g., 95% confidence)

How should I design experiments to investigate NWMN_1476 function?

Designing rigorous experiments to investigate an uncharacterized protein like NWMN_1476 requires careful planning and appropriate controls:

  • Define clear research questions: Each experiment should address specific aspects of the protein's:

    • Localization

    • Biochemical activity

    • Interaction partners

    • Physiological role

    • Contribution to stress responses

  • Develop a systematic research design:

    • Use quantitative approaches whenever possible

    • Include appropriate positive and negative controls

    • Plan for biological and technical replicates (minimum n=3)

    • Design experiments with sufficient statistical power

    • Consider both targeted and unbiased approaches

  • Implement control measures:

    • Use isogenic strains differing only in NWMN_1476 expression

    • Include complementation studies to confirm phenotypes

    • Test multiple independent mutants to rule out secondary mutations

    • Use empty vector controls for overexpression studies

    • Include scrambled siRNA/sgRNA controls for knockdown experiments

  • Consider experimental limitations:

    • Account for potential polar effects in genetic studies

    • Be aware of tag-induced artifacts in localization or interaction studies

    • Address potential redundancy with paralogous proteins

    • Include time-course analyses for dynamic processes

    • Test multiple environmental conditions to avoid context-dependent false negatives

  • Data analysis planning:

    • Determine appropriate statistical tests before conducting experiments

    • Establish thresholds for significance in advance

    • Plan for multiple testing corrections in high-throughput studies

    • Consider both biological and statistical significance in interpretation

Following established research design principles ensures that experiments will produce reliable, reproducible data that advances understanding of NWMN_1476 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.