Recombinant Staphylococcus aureus UPF0365 protein SA1402 (SA1402)

Shipped with Ice Packs
In Stock

Description

Introduction

Staphylococcus aureus is a versatile bacterium capable of adapting to diverse environmental conditions, which contributes to its role as a commensal organism and a significant cause of nosocomial and community-acquired infections . Among its numerous proteins, the UPF0365 protein SA1402 (SA1402) is a protein of unknown function that has been identified in Staphylococcus aureus . Recombinant SA1402 is produced using genetic engineering techniques to create a purified protein for research purposes .

Characteristics of SA1402

SA1402 is referred to as UPF0365 protein SA1402, with UPF0365 denoting a protein family of unknown function . The SA1402 protein is a full length protein consisting of 329 amino acids .

Production and Availability

Recombinant SA1402 protein is produced in various expression systems, including E. coli, yeast, baculovirus, or mammalian cells . It is available from commercial sources for research purposes, typically with a purity level of >85% . The protein is usually supplied in a liquid form containing glycerol for stability and should be stored at -20°C or -80°C to maintain its integrity . Repeated freezing and thawing cycles are not recommended .

Amino Acid Sequence

The amino acid sequence of SA1402 is as follows :
MFSLSFIVIAVIIIVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
floA; SA1402; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Staphylococcus aureus (strain N315)
Target Names
SA1402
Target Protein Sequence
MFSLSFIVIAVIIIVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a significant role in regulating membrane fluidity.

Database Links

KEGG: sau:SA1402

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

How should researchers properly store and handle recombinant SA1402 protein to maintain activity?

Optimal storage conditions for recombinant SA1402 protein require careful temperature management to preserve structural integrity and functional activity. The protein should be stored at -20°C for regular use, while extended storage benefits from lower temperatures (-20°C or -80°C) . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for stability .

For experimental workflows, researchers should:

  • Prepare working aliquots to avoid repeated freeze-thaw cycles, which can significantly degrade protein structure and function

  • Store working aliquots at 4°C for up to one week

  • Avoid repeated freezing and thawing of the stock solution

  • Consider stabilizing additives when diluting from stock solutions

  • Validate protein activity after extended storage periods using appropriate functional assays

These handling protocols ensure experimental reproducibility and minimize activity loss during research applications.

What expression systems are commonly used for recombinant SA1402 production?

Recombinant SA1402 protein can be produced in several expression systems, each offering different advantages depending on research requirements. The most common expression host is E. coli, which provides cost-effective, high-yield production suitable for structural and biochemical studies . Alternative expression systems include yeast, baculovirus, and mammalian cell systems, which may offer benefits for specific applications .

Expression SystemAdvantagesLimitationsTypical Applications
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modificationsStructural studies, protein-protein interaction assays
YeastEukaryotic post-translational modifications, secretionLower yield than E. coliFunctional studies requiring glycosylation
BaculovirusComplex eukaryotic modifications, high expressionTime-consuming, technically demandingEnzymatic assays, antibody production
MammalianNative-like folding and modificationsHighest cost, lowest yieldInteraction studies with host factors

Selection of the appropriate expression system should be based on experimental objectives, required protein modifications, and downstream applications .

How can researchers effectively investigate potential functions of the uncharacterized UPF0365 protein SA1402?

Investigating uncharacterized proteins like SA1402 requires a multifaceted approach combining computational prediction, molecular techniques, and phenotypic analysis. Researchers should implement the following methodological workflow:

  • Computational characterization:

    • Perform sequence homology analyses against characterized proteins

    • Predict functional domains using tools like InterPro, PFAM, and SMART

    • Apply structural modeling to identify potential binding sites or catalytic centers

    • Examine genomic context and co-expression patterns

  • Molecular characterization:

    • Generate gene deletion mutants using CRISPR-Cas9 or allelic exchange

    • Perform complementation studies with wild-type and mutant variants

    • Create reporter fusions to study expression patterns under different conditions

    • Employ bacterial two-hybrid or co-immunoprecipitation to identify interaction partners

  • Phenotypic characterization:

    • Assess growth characteristics under various environmental stresses

    • Evaluate changes in virulence in appropriate infection models

    • Measure alterations in membrane properties if predicted to be membrane-associated

    • Test sensitivity to antimicrobials and host defense mechanisms

This systematic approach creates multiple lines of evidence to elucidate the physiological role of SA1402, potentially revealing novel therapeutic targets .

What are the challenges in developing neutralizing agents against SA1402 if it proves to have virulence functions?

Developing neutralizing agents against bacterial proteins like SA1402 presents several research challenges that must be methodically addressed:

  • Target validation challenges:

    • Establishing definitive causal relationship between SA1402 and virulence

    • Determining essentiality for bacterial survival versus pathogenesis

    • Accounting for potential redundancy in bacterial virulence mechanisms

  • Structural design challenges:

    • Identifying accessible epitopes or binding pockets if membrane-associated

    • Engineering high-affinity binding proteins through directed evolution

    • Optimizing stability of engineered neutralizing proteins in physiological conditions

  • Functional validation challenges:

    • Developing appropriate assays to measure neutralization efficacy

    • Testing in relevant infection models that recapitulate human disease

    • Addressing potential immune responses to therapeutic proteins

The approach used by researchers who developed a treatment for S. aureus enterotoxin B illustrates a potential methodology: they engineered a protein with increasing affinity for the toxin using yeast display technology and mutagenesis to create a soluble protein with dramatically enhanced binding capacity . This approach of taking receptors that bind to bacterial proteins and enhancing their affinity could potentially be applied to SA1402 if it proves to have virulence functions.

How does SA1402 compare structurally and functionally with other UPF0365 family proteins from different Staphylococcus strains?

Comparative analysis of UPF0365 family proteins across Staphylococcus strains reveals evolutionary insights and strain-specific adaptations. While comprehensive comparative data is limited, examining the relationship between SA1402 and related proteins like SAR1650 provides valuable research direction .

ProteinStrainSequence SimilarityPredicted DomainsNotable Differences
SA1402S. aureus N315ReferenceTransmembrane, potential signaling domainsStrain-specific C-terminal region
SAR1650S. aureus MRSA252~85-95% (estimated)Similar domain architectureVariations in potential interaction motifs
Other UPF0365 homologsVarious S. aureus strains70-98% depending on strainConserved core structureHypervariable regions potentially involved in host adaptation

Researchers investigating functional differences should:

  • Perform systematic mutagenesis of variable regions to identify functional determinants

  • Assess expression patterns across different growth conditions and infection models

  • Compare protein-protein interaction networks between homologs

  • Evaluate strain-specific phenotypes associated with gene deletion

This comparative approach may reveal how structural variations contribute to strain-specific virulence or adaptation mechanisms .

What are the optimal conditions for protein-protein interaction studies involving SA1402?

Protein-protein interaction studies with SA1402 require careful methodological considerations due to its predicted membrane association. Researchers should optimize experimental conditions based on specific assay requirements:

For in vitro interaction studies:

  • Buffer selection: Use detergent-containing buffers (e.g., 0.1% DDM or 0.5% CHAPS) to maintain solubility while preserving native structure

  • Temperature control: Perform binding experiments at physiological temperature (37°C) to reflect bacterial environment

  • Salt concentration: Optimize ionic strength (typically 100-150mM NaCl) to reduce non-specific interactions

  • pH consideration: Maintain pH 7.2-7.4 to mimic bacterial cytoplasmic conditions

For cell-based interaction studies:

When interpreting results, researchers should account for potential conformational changes induced by membrane extraction and consider if interactions occur in membrane microdomains .

What purification strategies yield the highest purity and activity for recombinant SA1402?

Efficient purification of recombinant SA1402 requires a strategic approach to maintain structural integrity while achieving high purity (>90%) . Based on available data and properties of similar membrane-associated proteins, the following purification workflow is recommended:

  • Affinity chromatography:

    • If His-tagged: Use Ni-NTA columns with imidazole gradient elution (20-250 mM)

    • Alternative tags: GST or MBP fusion systems can improve solubility and provide affinity handles

  • Detergent selection:

    • Mild detergents (0.1% DDM, 1% CHAPS, or 0.5% Triton X-100) for membrane protein extraction

    • Detergent concentration should be maintained above critical micelle concentration throughout purification

  • Secondary purification:

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography if additional purity is required

  • Quality control metrics:

    • SDS-PAGE and western blotting to confirm identity and purity

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to verify secondary structure

This purification approach typically yields protein with >90% purity suitable for structural and functional studies while preserving native conformations .

How can researchers effectively assess the impact of SA1402 deletion or overexpression on S. aureus virulence?

Evaluating the impact of SA1402 manipulation on S. aureus virulence requires a comprehensive experimental framework combining molecular genetics, phenotypic characterization, and infection models. Researchers should implement the following methodological approach:

For genetic manipulation:

  • Generate precise deletion mutants (ΔSA1402) using allelic exchange or CRISPR-Cas9

  • Create complementation strains with wild-type and site-directed mutants

  • Develop controlled expression systems (inducible promoters) for overexpression studies

  • Construct reporter fusions (SA1402-GFP) to monitor protein localization

For phenotypic characterization:

  • Growth kinetics under various stress conditions (oxidative, pH, temperature, osmotic)

  • Biofilm formation assays (crystal violet staining, confocal microscopy)

  • Antibiotic susceptibility testing (MIC determination)

  • Cell wall/membrane integrity assays (detergent sensitivity, autolysis)

For virulence assessment:

  • In vitro infection models:

    • Invasion/adhesion assays with relevant cell lines

    • Intracellular survival in phagocytes

    • Cytotoxicity measurements

  • In vivo infection models:

    • Murine systemic infection model

    • Skin and soft tissue infection model

    • Organ-specific (e.g., endocarditis, osteomyelitis) models as relevant

This systematic approach provides comprehensive evaluation of SA1402's potential role in S. aureus pathogenesis and identifies specific virulence mechanisms affected by the protein .

What computational approaches can predict SA1402 function based on sequence and structural features?

Computational prediction of SA1402 function requires integration of multiple bioinformatic approaches to generate testable hypotheses. Researchers should implement the following analytical pipeline:

  • Sequence-based analysis:

    • BLAST and HHpred searches against characterized protein databases

    • Multiple sequence alignment of UPF0365 family members to identify conserved residues

    • Motif scanning using PROSITE, PFAM, and specialized bacterial virulence databases

    • Transmembrane topology prediction using TMHMM, Phobius, and CCTOP

  • Structure-based analysis:

    • Ab initio protein structure prediction using AlphaFold2 or RoseTTAFold

    • Template-based modeling if structural homologs exist

    • Binding pocket identification and characterization

    • Molecular dynamics simulations to assess conformational flexibility

  • Systems-level analysis:

    • Genomic context examination for operonic structure and co-evolution

    • Analysis of transcriptomic data to identify co-expressed genes

    • Protein-protein interaction network prediction

    • Pathway enrichment analysis

  • Integration and hypothesis generation:

    • Consensus function prediction from multiple methods

    • Identification of critical residues for experimental validation

    • Proposed biological processes for targeted investigation

This computational framework provides a foundation for focused experimental studies while maximizing information extraction from existing data .

How does the membrane topology of SA1402 influence its potential interactions with host or bacterial factors?

The predicted membrane topology of SA1402 suggests critical functional implications for its biological role and interaction capabilities. Analysis of the amino acid sequence indicates an N-terminal transmembrane region (approximately residues 1-30) followed by a larger C-terminal domain likely exposed to either the extracellular environment or periplasmic space .

This topology impacts potential interactions in several ways:

  • Localization determinants:

    • The hydrophobic N-terminal sequence (MFSLSFIVIAVIIIVALLILFSFVPI) likely serves as a membrane anchor

    • The C-terminal domain (approximately residues 31-329) contains potential interaction sites

    • Charged residue distribution suggests outside-facing orientation of the C-terminal domain

  • Functional implications:

    • Membrane anchoring positions the protein at the bacterial-host interface

    • The exposed domain may interact with host immune factors or extracellular matrix

    • Alternatively, it may participate in bacterial cell wall synthesis or remodeling

  • Experimental considerations:

    • Protein truncation studies should preserve the membrane anchor for localization studies

    • Topology mapping using reporter fusions or accessibility labeling confirms orientation

    • Interaction studies should account for membrane constraints on protein conformation

  • Therapeutic relevance:

    • Exposed epitopes may be accessible to antibodies or inhibitors

    • Membrane anchoring may protect certain domains from immune recognition

Researchers investigating SA1402 should design experiments that preserve or account for this topology to obtain physiologically relevant results .

How does SA1402 compare to characterized virulence factors in S. aureus, such as CHIPS?

While SA1402 remains functionally uncharacterized, comparative analysis with well-studied S. aureus virulence factors provides valuable insights into its potential role. CHIPS (Chemotaxis Inhibitory Protein of S. aureus) represents a particularly informative comparison as a characterized immune evasion protein .

FeatureSA1402 (UPF0365)CHIPS
Size329 amino acids121 amino acids (residues 29-149 used in research)
Cellular locationPredicted membrane-associatedSecreted
Known functionUncharacterizedInhibits neutrophil and monocyte responses
Molecular targetsUnknownC5a receptor (C5aR) and formylated peptide receptor (FPR)
MechanismUnknownBlocks C5a- and fMLP-induced calcium responses
Evolutionary conservationPresent across multiple S. aureus strainsVariable presence, phage-encoded
Clinical significanceTo be determinedPrevents phagocytosis, contributes to immune evasion

Methodological considerations for comparative research:

  • Expression pattern analysis during infection to compare with known virulence factors

  • Evaluation of immunomodulatory effects in parallel with CHIPS

  • Investigation of potential synergistic effects with established virulence factors

  • Assessment of conservation across clinical isolates to determine importance

This comparative approach may reveal if SA1402 represents a novel class of virulence factors or shares functional characteristics with established virulence mechanisms .

What is known about the expression regulation of SA1402 compared to other S. aureus proteins?

Understanding SA1402 expression regulation provides insights into its biological role and potential involvement in S. aureus pathogenesis. While specific regulatory data for SA1402 is limited, comparative analysis with general S. aureus regulatory networks suggests several research directions:

  • Potential regulatory elements:

    • Promoter analysis may reveal binding sites for key S. aureus regulators (Agr, SarA, SaeRS)

    • Presence of STAR sequences would suggest post-transcriptional regulation

    • Evaluation of 5' UTR structures may indicate riboswitch or attenuator mechanisms

  • Comparative expression patterns:

    • Core genome proteins typically show constitutive expression

    • Virulence factors often display growth phase-dependent or environmental regulation

    • Membrane proteins frequently respond to cell envelope stress signals

  • Methodological approaches:

    • qRT-PCR analysis under various growth conditions and stresses

    • Transcriptomic comparison across growth phases and infection models

    • Reporter fusion studies to visualize expression dynamics

    • Chromatin immunoprecipitation to identify transcription factor binding

  • Regulatory network integration:

    • Analysis of co-regulated genes to identify functional relationships

    • Characterization of expression changes in regulatory mutants

    • Evaluation of expression during biofilm formation versus planktonic growth

This comparative regulatory analysis framework helps position SA1402 within the broader context of S. aureus biology and may reveal conditions where the protein plays critical roles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.