Staphylococcus aureus is a versatile bacterium capable of adapting to diverse environmental conditions, which contributes to its role as a commensal organism and a significant cause of nosocomial and community-acquired infections . Among its numerous proteins, the UPF0365 protein SA1402 (SA1402) is a protein of unknown function that has been identified in Staphylococcus aureus . Recombinant SA1402 is produced using genetic engineering techniques to create a purified protein for research purposes .
SA1402 is referred to as UPF0365 protein SA1402, with UPF0365 denoting a protein family of unknown function . The SA1402 protein is a full length protein consisting of 329 amino acids .
Recombinant SA1402 protein is produced in various expression systems, including E. coli, yeast, baculovirus, or mammalian cells . It is available from commercial sources for research purposes, typically with a purity level of >85% . The protein is usually supplied in a liquid form containing glycerol for stability and should be stored at -20°C or -80°C to maintain its integrity . Repeated freezing and thawing cycles are not recommended .
The amino acid sequence of SA1402 is as follows :
MFSLSFIVIAVIIIVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH
Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a significant role in regulating membrane fluidity.
KEGG: sau:SA1402
Optimal storage conditions for recombinant SA1402 protein require careful temperature management to preserve structural integrity and functional activity. The protein should be stored at -20°C for regular use, while extended storage benefits from lower temperatures (-20°C or -80°C) . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for stability .
For experimental workflows, researchers should:
Prepare working aliquots to avoid repeated freeze-thaw cycles, which can significantly degrade protein structure and function
Store working aliquots at 4°C for up to one week
Avoid repeated freezing and thawing of the stock solution
Consider stabilizing additives when diluting from stock solutions
Validate protein activity after extended storage periods using appropriate functional assays
These handling protocols ensure experimental reproducibility and minimize activity loss during research applications.
Recombinant SA1402 protein can be produced in several expression systems, each offering different advantages depending on research requirements. The most common expression host is E. coli, which provides cost-effective, high-yield production suitable for structural and biochemical studies . Alternative expression systems include yeast, baculovirus, and mammalian cell systems, which may offer benefits for specific applications .
| Expression System | Advantages | Limitations | Typical Applications |
|---|---|---|---|
| E. coli | High yield, cost-effective, rapid production | Limited post-translational modifications | Structural studies, protein-protein interaction assays |
| Yeast | Eukaryotic post-translational modifications, secretion | Lower yield than E. coli | Functional studies requiring glycosylation |
| Baculovirus | Complex eukaryotic modifications, high expression | Time-consuming, technically demanding | Enzymatic assays, antibody production |
| Mammalian | Native-like folding and modifications | Highest cost, lowest yield | Interaction studies with host factors |
Selection of the appropriate expression system should be based on experimental objectives, required protein modifications, and downstream applications .
Investigating uncharacterized proteins like SA1402 requires a multifaceted approach combining computational prediction, molecular techniques, and phenotypic analysis. Researchers should implement the following methodological workflow:
Computational characterization:
Perform sequence homology analyses against characterized proteins
Predict functional domains using tools like InterPro, PFAM, and SMART
Apply structural modeling to identify potential binding sites or catalytic centers
Examine genomic context and co-expression patterns
Molecular characterization:
Generate gene deletion mutants using CRISPR-Cas9 or allelic exchange
Perform complementation studies with wild-type and mutant variants
Create reporter fusions to study expression patterns under different conditions
Employ bacterial two-hybrid or co-immunoprecipitation to identify interaction partners
Phenotypic characterization:
Assess growth characteristics under various environmental stresses
Evaluate changes in virulence in appropriate infection models
Measure alterations in membrane properties if predicted to be membrane-associated
Test sensitivity to antimicrobials and host defense mechanisms
This systematic approach creates multiple lines of evidence to elucidate the physiological role of SA1402, potentially revealing novel therapeutic targets .
Developing neutralizing agents against bacterial proteins like SA1402 presents several research challenges that must be methodically addressed:
Target validation challenges:
Establishing definitive causal relationship between SA1402 and virulence
Determining essentiality for bacterial survival versus pathogenesis
Accounting for potential redundancy in bacterial virulence mechanisms
Structural design challenges:
Identifying accessible epitopes or binding pockets if membrane-associated
Engineering high-affinity binding proteins through directed evolution
Optimizing stability of engineered neutralizing proteins in physiological conditions
Functional validation challenges:
Developing appropriate assays to measure neutralization efficacy
Testing in relevant infection models that recapitulate human disease
Addressing potential immune responses to therapeutic proteins
The approach used by researchers who developed a treatment for S. aureus enterotoxin B illustrates a potential methodology: they engineered a protein with increasing affinity for the toxin using yeast display technology and mutagenesis to create a soluble protein with dramatically enhanced binding capacity . This approach of taking receptors that bind to bacterial proteins and enhancing their affinity could potentially be applied to SA1402 if it proves to have virulence functions.
Comparative analysis of UPF0365 family proteins across Staphylococcus strains reveals evolutionary insights and strain-specific adaptations. While comprehensive comparative data is limited, examining the relationship between SA1402 and related proteins like SAR1650 provides valuable research direction .
| Protein | Strain | Sequence Similarity | Predicted Domains | Notable Differences |
|---|---|---|---|---|
| SA1402 | S. aureus N315 | Reference | Transmembrane, potential signaling domains | Strain-specific C-terminal region |
| SAR1650 | S. aureus MRSA252 | ~85-95% (estimated) | Similar domain architecture | Variations in potential interaction motifs |
| Other UPF0365 homologs | Various S. aureus strains | 70-98% depending on strain | Conserved core structure | Hypervariable regions potentially involved in host adaptation |
Researchers investigating functional differences should:
Perform systematic mutagenesis of variable regions to identify functional determinants
Assess expression patterns across different growth conditions and infection models
Compare protein-protein interaction networks between homologs
Evaluate strain-specific phenotypes associated with gene deletion
This comparative approach may reveal how structural variations contribute to strain-specific virulence or adaptation mechanisms .
Protein-protein interaction studies with SA1402 require careful methodological considerations due to its predicted membrane association. Researchers should optimize experimental conditions based on specific assay requirements:
For in vitro interaction studies:
Buffer selection: Use detergent-containing buffers (e.g., 0.1% DDM or 0.5% CHAPS) to maintain solubility while preserving native structure
Temperature control: Perform binding experiments at physiological temperature (37°C) to reflect bacterial environment
Salt concentration: Optimize ionic strength (typically 100-150mM NaCl) to reduce non-specific interactions
pH consideration: Maintain pH 7.2-7.4 to mimic bacterial cytoplasmic conditions
For cell-based interaction studies:
When interpreting results, researchers should account for potential conformational changes induced by membrane extraction and consider if interactions occur in membrane microdomains .
Efficient purification of recombinant SA1402 requires a strategic approach to maintain structural integrity while achieving high purity (>90%) . Based on available data and properties of similar membrane-associated proteins, the following purification workflow is recommended:
Affinity chromatography:
If His-tagged: Use Ni-NTA columns with imidazole gradient elution (20-250 mM)
Alternative tags: GST or MBP fusion systems can improve solubility and provide affinity handles
Detergent selection:
Mild detergents (0.1% DDM, 1% CHAPS, or 0.5% Triton X-100) for membrane protein extraction
Detergent concentration should be maintained above critical micelle concentration throughout purification
Secondary purification:
Size exclusion chromatography to separate monomeric protein from aggregates
Ion exchange chromatography if additional purity is required
Quality control metrics:
SDS-PAGE and western blotting to confirm identity and purity
Dynamic light scattering to assess homogeneity
Circular dichroism to verify secondary structure
This purification approach typically yields protein with >90% purity suitable for structural and functional studies while preserving native conformations .
Evaluating the impact of SA1402 manipulation on S. aureus virulence requires a comprehensive experimental framework combining molecular genetics, phenotypic characterization, and infection models. Researchers should implement the following methodological approach:
For genetic manipulation:
Generate precise deletion mutants (ΔSA1402) using allelic exchange or CRISPR-Cas9
Create complementation strains with wild-type and site-directed mutants
Develop controlled expression systems (inducible promoters) for overexpression studies
Construct reporter fusions (SA1402-GFP) to monitor protein localization
For phenotypic characterization:
Growth kinetics under various stress conditions (oxidative, pH, temperature, osmotic)
Biofilm formation assays (crystal violet staining, confocal microscopy)
Antibiotic susceptibility testing (MIC determination)
Cell wall/membrane integrity assays (detergent sensitivity, autolysis)
For virulence assessment:
In vitro infection models:
Invasion/adhesion assays with relevant cell lines
Intracellular survival in phagocytes
Cytotoxicity measurements
In vivo infection models:
Murine systemic infection model
Skin and soft tissue infection model
Organ-specific (e.g., endocarditis, osteomyelitis) models as relevant
This systematic approach provides comprehensive evaluation of SA1402's potential role in S. aureus pathogenesis and identifies specific virulence mechanisms affected by the protein .
Computational prediction of SA1402 function requires integration of multiple bioinformatic approaches to generate testable hypotheses. Researchers should implement the following analytical pipeline:
Sequence-based analysis:
BLAST and HHpred searches against characterized protein databases
Multiple sequence alignment of UPF0365 family members to identify conserved residues
Motif scanning using PROSITE, PFAM, and specialized bacterial virulence databases
Transmembrane topology prediction using TMHMM, Phobius, and CCTOP
Structure-based analysis:
Ab initio protein structure prediction using AlphaFold2 or RoseTTAFold
Template-based modeling if structural homologs exist
Binding pocket identification and characterization
Molecular dynamics simulations to assess conformational flexibility
Systems-level analysis:
Genomic context examination for operonic structure and co-evolution
Analysis of transcriptomic data to identify co-expressed genes
Protein-protein interaction network prediction
Pathway enrichment analysis
Integration and hypothesis generation:
Consensus function prediction from multiple methods
Identification of critical residues for experimental validation
Proposed biological processes for targeted investigation
This computational framework provides a foundation for focused experimental studies while maximizing information extraction from existing data .
The predicted membrane topology of SA1402 suggests critical functional implications for its biological role and interaction capabilities. Analysis of the amino acid sequence indicates an N-terminal transmembrane region (approximately residues 1-30) followed by a larger C-terminal domain likely exposed to either the extracellular environment or periplasmic space .
This topology impacts potential interactions in several ways:
Localization determinants:
The hydrophobic N-terminal sequence (MFSLSFIVIAVIIIVALLILFSFVPI) likely serves as a membrane anchor
The C-terminal domain (approximately residues 31-329) contains potential interaction sites
Charged residue distribution suggests outside-facing orientation of the C-terminal domain
Functional implications:
Membrane anchoring positions the protein at the bacterial-host interface
The exposed domain may interact with host immune factors or extracellular matrix
Alternatively, it may participate in bacterial cell wall synthesis or remodeling
Experimental considerations:
Protein truncation studies should preserve the membrane anchor for localization studies
Topology mapping using reporter fusions or accessibility labeling confirms orientation
Interaction studies should account for membrane constraints on protein conformation
Therapeutic relevance:
Exposed epitopes may be accessible to antibodies or inhibitors
Membrane anchoring may protect certain domains from immune recognition
Researchers investigating SA1402 should design experiments that preserve or account for this topology to obtain physiologically relevant results .
While SA1402 remains functionally uncharacterized, comparative analysis with well-studied S. aureus virulence factors provides valuable insights into its potential role. CHIPS (Chemotaxis Inhibitory Protein of S. aureus) represents a particularly informative comparison as a characterized immune evasion protein .
| Feature | SA1402 (UPF0365) | CHIPS |
|---|---|---|
| Size | 329 amino acids | 121 amino acids (residues 29-149 used in research) |
| Cellular location | Predicted membrane-associated | Secreted |
| Known function | Uncharacterized | Inhibits neutrophil and monocyte responses |
| Molecular targets | Unknown | C5a receptor (C5aR) and formylated peptide receptor (FPR) |
| Mechanism | Unknown | Blocks C5a- and fMLP-induced calcium responses |
| Evolutionary conservation | Present across multiple S. aureus strains | Variable presence, phage-encoded |
| Clinical significance | To be determined | Prevents phagocytosis, contributes to immune evasion |
Methodological considerations for comparative research:
Expression pattern analysis during infection to compare with known virulence factors
Evaluation of immunomodulatory effects in parallel with CHIPS
Investigation of potential synergistic effects with established virulence factors
Assessment of conservation across clinical isolates to determine importance
This comparative approach may reveal if SA1402 represents a novel class of virulence factors or shares functional characteristics with established virulence mechanisms .
Understanding SA1402 expression regulation provides insights into its biological role and potential involvement in S. aureus pathogenesis. While specific regulatory data for SA1402 is limited, comparative analysis with general S. aureus regulatory networks suggests several research directions:
Potential regulatory elements:
Promoter analysis may reveal binding sites for key S. aureus regulators (Agr, SarA, SaeRS)
Presence of STAR sequences would suggest post-transcriptional regulation
Evaluation of 5' UTR structures may indicate riboswitch or attenuator mechanisms
Comparative expression patterns:
Core genome proteins typically show constitutive expression
Virulence factors often display growth phase-dependent or environmental regulation
Membrane proteins frequently respond to cell envelope stress signals
Methodological approaches:
qRT-PCR analysis under various growth conditions and stresses
Transcriptomic comparison across growth phases and infection models
Reporter fusion studies to visualize expression dynamics
Chromatin immunoprecipitation to identify transcription factor binding
Regulatory network integration:
Analysis of co-regulated genes to identify functional relationships
Characterization of expression changes in regulatory mutants
Evaluation of expression during biofilm formation versus planktonic growth
This comparative regulatory analysis framework helps position SA1402 within the broader context of S. aureus biology and may reveal conditions where the protein plays critical roles .