Recombinant Staphylococcus aureus UPF0365 protein SACOL1630 (SACOL1630)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your requirements for preferential development of a specific tag.
Synonyms
floA; SACOL1630; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Staphylococcus aureus (strain COL)
Target Names
SACOL1630
Target Protein Sequence
MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH
Uniprot No.

Target Background

Function
Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are considered significant contributors to membrane fluidity.
Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What is Staphylococcus aureus UPF0365 protein SACOL1630?

SACOL1630 is a full-length protein belonging to the UPF0365 protein family found in Staphylococcus aureus. The UPF designation (Uncharacterized Protein Family) indicates that its complete functional characterization remains ongoing. Based on homology with other UPF0365 proteins like NWMN_1476, it appears to be related to flotillin-like proteins (FloA) that participate in membrane organization and cellular processes . The complete amino acid sequence spans approximately 329 residues, similar to its homologs, and contains characteristic membrane-associated domains that suggest involvement in bacterial membrane organization .

How does SACOL1630 differ from other S. aureus UPF0365 proteins such as NWMN_1476?

While both SACOL1630 and NWMN_1476 belong to the UPF0365 protein family in S. aureus, they originate from different S. aureus strains and may exhibit subtle sequence variations. NWMN_1476 (from strain Newman) has been annotated as flotillin-like protein FloA with a UniProt ID of A6QHB6 . Comparative sequence analysis between these proteins typically reveals high conservation of functional domains while showing strain-specific variations in non-critical regions. When designing experiments targeting SACOL1630, researchers should account for these strain-specific differences by performing multiple sequence alignments to identify conserved regions for antibody development or functional studies.

What expression systems are recommended for producing recombinant SACOL1630?

E. coli expression systems are most commonly used for recombinant production of S. aureus proteins like SACOL1630, particularly when studying structural properties . For functional studies requiring proper protein folding and post-translational modifications, researchers should consider:

  • E. coli systems: Ideal for high yield but may require optimization of codon usage and solubility tags

  • Yeast expression systems: Better for proteins requiring eukaryotic-like post-translational modifications

  • Insect cell systems: Suitable for membrane-associated proteins requiring complex folding

The selection depends on research objectives - structural studies may prioritize quantity over native conformation, while functional assays require properly folded protein . Based on successful expression of the homologous NWMN_1476 protein, E. coli systems with N-terminal His-tags have demonstrated effectiveness for UPF0365 family proteins .

What purification strategies yield high-purity SACOL1630 protein?

For SACOL1630 purification, a multi-step approach typically yields the best results:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

  • Intermediate purification: Ion exchange chromatography to separate based on charge differences

  • Polishing step: Size exclusion chromatography to remove aggregates and ensure monodispersity

This strategy has shown effectiveness with homologous proteins like NWMN_1476 . Researchers should monitor purity via SDS-PAGE at each step, aiming for >90% purity. For membrane-associated proteins like SACOL1630, adding low concentrations (0.05-0.1%) of mild detergents (DDM or CHAPS) throughout the purification process can improve yield and prevent aggregation. Final protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability .

How can researchers differentiate between functional roles of SACOL1630 and other flotillin-like proteins in S. aureus?

Differentiating the functional roles requires sophisticated experimental approaches:

  • Sequential gene knockout studies: Create single, double, and complementation mutants of SACOL1630 and related proteins

  • Domain swapping experiments: Exchange functional domains between SACOL1630 and other flotillin-like proteins to identify specific activity regions

  • Interactome mapping: Use pull-down assays coupled with mass spectrometry to identify differential protein interaction partners

Experimental ApproachAdvantagesLimitationsData Analysis Method
Gene knockoutDirect assessment of phenotypePotential compensatory mechanismsComparative phenotypic analysis
Domain swappingIdentifies functional regionsComplex cloning requiredStructure-function correlation
Interactome analysisComprehensive protein network viewResource intensiveNetwork analysis software (Cytoscape)

When interpreting results, researchers should account for potential functional redundancy among flotillin-like proteins that may mask phenotypic effects in single knockout studies. Cross-referencing with transcriptomic data during various growth phases can provide additional context for functional differentiation .

What methodological approaches best characterize SACOL1630's role in bacterial membrane organization?

To characterize SACOL1630's membrane organization role, researchers should implement complementary techniques:

  • Super-resolution microscopy: Techniques like STORM or PALM with fluorescently-tagged SACOL1630 can visualize protein clustering and distribution patterns within bacterial membranes at nanoscale resolution

  • Membrane fractionation with proteomics: Isolate membrane microdomains using detergent resistance methods followed by mass spectrometry to identify co-localized proteins

  • FRET analysis: Measure protein-protein interactions within membrane domains using acceptor photobleaching FRET between SACOL1630 and candidate interaction partners

For quantitative analysis of membrane localization, researchers should employ dual-channel imaging with appropriate membrane markers and calculate co-localization coefficients (Pearson's or Mander's). Membrane microdomain isolation requires careful optimization of detergent concentrations and temperatures to preserve native protein interactions .

How should researchers interpret contradictory data regarding SACOL1630 function in different experimental systems?

When facing contradictory data about SACOL1630 function, implement this systematic analysis framework:

  • Context dependency analysis: Systematically compare experimental conditions (growth media, growth phase, strain backgrounds) that might explain discrepancies

  • Method-specific artifact assessment: Evaluate whether different detection methods might introduce bias (e.g., tag interference with protein function)

  • Statistical robustness evaluation: Assess sample sizes, technical replicates, and statistical methods used in contradictory studies

Create a comparison table of contradictory findings that includes:

  • Experimental conditions

  • Methodological approaches

  • Statistical significance

  • Sample sizes

  • Controls used

Researchers should prioritize orthogonal validation - confirming findings using methodologically distinct approaches to overcome technique-specific limitations. For unresolved contradictions, consider designing experiments specifically to test competing hypotheses under standardized conditions .

What are the optimal storage and reconstitution conditions for maintaining SACOL1630 activity?

For optimal storage and reconstitution of recombinant SACOL1630:

Long-term storage:

  • Store lyophilized protein at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

  • Consider aliquoting reconstituted protein with 50% glycerol for multiple use cases

Reconstitution protocol:

  • Centrifuge lyophilized protein vial briefly before opening

  • Reconstitute to 0.1-1.0 mg/mL using deionized sterile water

  • Add glycerol to 5-50% final concentration for stability

  • Store working aliquots at 4°C for up to one week

The ideal storage buffer composition is Tris/PBS-based buffer with 6% trehalose at pH 8.0 . Activity assays should be performed immediately after reconstitution and after storage to assess stability over time. For membrane-associated proteins like SACOL1630, addition of mild detergents during reconstitution may help maintain native conformation and prevent aggregation .

What experimental design best evaluates SACOL1630's role in S. aureus virulence?

To evaluate SACOL1630's role in virulence, implement a multi-level experimental design:

In vitro components:

  • Adhesion assays: Compare wild-type and SACOL1630 knockout strains for adherence to host cell lines

  • Biofilm formation: Quantify biofilm formation using crystal violet staining and confocal microscopy

  • Immune evasion: Assess survival in neutrophil killing assays and complement resistance tests

In vivo components:

  • Animal infection models: Use murine models of systemic infection and tissue-specific models

  • Competitive index assays: Co-infect with wild-type and mutant strains to directly compare fitness

  • Bacterial burden tracking: Monitor tissue colonization over time using bioluminescent imaging

Assessment ParameterMethodologyReadoutStatistical Analysis
Adhesion capacityCell culture binding assay% adherent bacteriat-test or ANOVA
Biofilm formationCrystal violet stainingAbsorbance at 595nmt-test with multiple timepoints
Virulence in vivoSurvival curvesKaplan-Meier plotLog-rank test
Tissue burdenCFU enumerationLog10 CFU/g tissueMann-Whitney U test

Include complementation controls to confirm phenotypes are specifically due to SACOL1630 loss. Additionally, gene expression analysis during infection provides context for when SACOL1630 is actively transcribed during pathogenesis .

What proteomic approaches are most effective for studying SACOL1630 interaction partners?

For comprehensive identification of SACOL1630 interaction partners, employ these complementary proteomic approaches:

  • Co-immunoprecipitation with LC-MS/MS: Use anti-SACOL1630 antibodies or tagged protein versions to pull down protein complexes, followed by mass spectrometry identification

  • Proximity-dependent biotin labeling (BioID or APEX): Fuse SACOL1630 to a biotin ligase to label proximal proteins in living bacteria

  • Chemical cross-linking mass spectrometry (XL-MS): Use membrane-permeable crosslinkers to capture transient interactions before MS analysis

For effective implementation, consider:

  • Expression levels: Maintain near-native expression to avoid artificial interactions

  • Negative controls: Include non-specific IgG pulldowns or unrelated bacterial proteins fused to the same tags

  • Validation: Confirm key interactions using reciprocal pulldowns and co-localization studies

Data analysis should include:

  • Enrichment calculation against controls

  • Filtering based on spectral counts

  • Network analysis of identified interactions

The 2D-DIGE gel electrophoresis approach can be used to identify differentially expressed proteins in SACOL1630 knockout strains compared to wild-type, providing indirect evidence of functional pathways involving this protein .

How can researchers quantitatively assess the impact of SACOL1630 on membrane domain formation?

To quantitatively assess SACOL1630's impact on membrane domain formation:

  • Fluorescence recovery after photobleaching (FRAP):

    • Tag membrane proteins with fluorescent markers

    • Measure diffusion rates in wild-type vs. SACOL1630 knockout strains

    • Calculate diffusion coefficients and mobile fractions

  • Atomic force microscopy (AFM):

    • Prepare membrane patches from wild-type and mutant bacteria

    • Measure nanomechanical properties of membrane domains

    • Quantify domain size, height, and stiffness

  • Detergent resistance membrane (DRM) isolation:

    • Isolate membrane fractions using density gradient centrifugation

    • Compare protein and lipid profiles between fractions

    • Quantify changes in domain-associated protein distribution

ParameterWild-type measurementΔSACOL1630 measurementAnalysis method
Diffusion coefficientD = X μm²/sD = Y μm²/sNon-linear regression of FRAP recovery
Domain sizeZ nmW nmParticle analysis of AFM images
Protein distribution in DRMs% in each fraction% in each fractionDensitometry of Western blots

Statistical analysis should include multiple biological replicates (n≥3) and appropriate tests for significance. Consider complementary visualization using transmission electron microscopy with immunogold labeling to correlate quantitative measures with structural observations .

What are common pitfalls when interpreting phenotypic changes in SACOL1630 knockout strains?

When interpreting phenotypic changes in SACOL1630 knockout strains, researchers should be aware of these common pitfalls:

  • Functional redundancy: Related proteins may compensate for SACOL1630 loss, masking phenotypes. Solution: Create multiple knockout strains of related proteins and assess combinatorial effects.

  • Polar effects on adjacent genes: Knockout constructs may disrupt expression of neighboring genes. Solution: Use clean deletion methods and complement with SACOL1630 expressed from a neutral site.

  • Secondary mutations: Adaptation to SACOL1630 loss may select for compensatory mutations. Solution: Create multiple independent knockout strains and sequence genomes to identify consistent phenotypes.

  • Growth rate confounding: Different growth rates between wild-type and mutant can confound phenotypic assays. Solution: Normalize data to growth parameters or use conditional expression systems.

Proper controls should include:

  • Wild-type parental strain

  • Complemented mutant strain

  • Empty vector control for complementation

  • Related protein knockouts for comparison

When analyzing growth curves and survival rates, consider both the growth rate (slope) and maximum density (plateau) as distinct parameters that may be differentially affected .

How should mass spectrometry data be analyzed when identifying post-translational modifications in SACOL1630?

For robust analysis of SACOL1630 post-translational modifications (PTMs) by mass spectrometry:

  • Sample preparation optimization:

    • Use multiple proteases (not just trypsin) to ensure complete sequence coverage

    • Enrich for specific modifications using appropriate techniques (TiO2 for phosphopeptides, lectin chromatography for glycopeptides)

  • Data acquisition strategy:

    • Implement data-dependent acquisition (DDA) with inclusion lists for predicted modified peptides

    • Consider parallel reaction monitoring (PRM) for targeted analysis of suspected modification sites

  • Search parameters:

    • Set appropriate mass tolerances based on instrument capabilities

    • Include common PTMs as variable modifications (phosphorylation, acetylation, methylation)

    • Use decoy database searches to control false discovery rates

  • Validation criteria:

    • Require detection of diagnostic fragment ions that localize modifications to specific residues

    • Implement confidence scoring that accounts for spectral quality

    • Validate biological significance through site-directed mutagenesis

When reporting PTM data, include:

  • Modified sequence with modification sites clearly indicated

  • Spectra showing diagnostic ions

  • Quantitative data on modification stoichiometry

  • Biological replicates demonstrating reproducibility

Cross-reference findings with known modification patterns in homologous proteins like NWMN_1476 to identify conserved regulatory mechanisms .

How might SACOL1630 contribute to antimicrobial resistance mechanisms in S. aureus?

The potential contribution of SACOL1630 to antimicrobial resistance requires investigation through these approaches:

  • Susceptibility profiling: Compare minimum inhibitory concentrations (MICs) of multiple antibiotic classes between wild-type and SACOL1630 mutant strains

  • Resistance mechanism assessment:

    • Measure membrane permeability using fluorescent dyes

    • Quantify efflux pump activity with substrate accumulation assays

    • Assess changes in cell wall thickness via electron microscopy

  • Stress response analysis:

    • Monitor SACOL1630 expression during antibiotic exposure

    • Determine if SACOL1630 co-localizes with resistance determinants during stress

Antibiotic ClassWild-type MICΔSACOL1630 MICFold ChangeProposed Mechanism
β-lactamsX μg/mlY μg/mlZ-foldChanges in membrane organization
GlycopeptidesX μg/mlY μg/mlZ-foldAltered cell wall synthesis
MacrolidesX μg/mlY μg/mlZ-foldEffect on efflux systems

As a membrane organization protein related to flotillins, SACOL1630 may affect the distribution and function of membrane proteins involved in drug efflux or uptake. Researchers should also investigate potential roles in biofilm-associated resistance, as membrane microdomains often contribute to biofilm formation processes .

What novel analytical techniques are emerging for studying SACOL1630 structure-function relationships?

Emerging techniques for SACOL1630 structure-function analysis include:

  • AlphaFold2 and structure prediction:

    • Generate computational models of SACOL1630 structure

    • Identify putative functional domains and interaction surfaces

    • Validate predictions through site-directed mutagenesis

  • Single-molecule techniques:

    • Single-molecule FRET to measure conformational changes

    • Optical tweezers to assess protein-protein interaction forces

    • Super-resolution microscopy for membrane organization visualization

  • Integrative structural biology approaches:

    • Combine low-resolution techniques (SAXS, cryo-EM) with computational modeling

    • Validate domain interfaces through crosslinking mass spectrometry

    • Assess dynamics through hydrogen-deuterium exchange MS

For membrane proteins like SACOL1630, native mass spectrometry in nanodiscs represents a particularly promising approach for studying the protein in a membrane-like environment. These techniques can overcome the traditional challenges of membrane protein structural biology and provide insights into how SACOL1630 functions within the bacterial membrane context .

How does SACOL1630 expression change during different growth phases and stress conditions?

To comprehensively characterize SACOL1630 expression patterns:

  • Growth phase analysis:

    • Measure transcript levels by qRT-PCR across growth curve

    • Quantify protein abundance using targeted proteomics

    • Correlate expression with physiological transitions

  • Stress response profiling:

    • Expose cultures to relevant stresses (antibiotics, oxidative stress, nutrient limitation)

    • Monitor expression changes using reporter constructs

    • Compare with known stress response markers

  • Host interaction dynamics:

    • Assess expression during host cell infection models

    • Track protein localization changes during phagocytosis

    • Determine if host factors modulate expression

Growth Phase/ConditionTranscript Level (Fold-Change)Protein Level (Fold-Change)Membrane Localization
Early exponentialBaselineBaselineDiffuse distribution
Late exponentialX-foldY-foldDomain formation
StationaryX-foldY-foldConcentrated domains
Antibiotic stressX-foldY-foldAltered pattern

Researchers should implement time-course experiments rather than single time-point measurements to capture the dynamics of expression changes. Transcriptomic data should be validated at the protein level, as post-transcriptional regulation can significantly impact actual protein abundance, particularly for membrane proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.