Recombinant Staphylococcus aureus UPF0365 protein SAHV_1560 (SAHV_1560)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
floA; SAHV_1560; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Staphylococcus aureus (strain Mu3 / ATCC 700698)
Target Names
SAHV_1560
Target Protein Sequence
MFSLSFIVIAVIIIVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a significant role in regulating membrane fluidity.

Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

How does SAHV_1560 contribute to S. aureus biology?

While the specific function of SAHV_1560 is not well-characterized in the available literature, its analysis should be considered within the broader context of S. aureus biology and pathogenesis. S. aureus is a gram-positive bacterium commonly found in the upper respiratory tract and on human skin, capable of causing various infections from minor skin conditions to life-threatening bloodstream infections .

Researchers investigating SAHV_1560's function should consider:

  • Protein localization studies to determine cellular distribution

  • Comparative genomics across S. aureus strains to identify conservation patterns

  • Transcriptional analysis to identify conditions that induce expression

  • Knockout studies to observe phenotypic changes in growth, survival, or virulence

The protein may participate in essential cellular processes, stress responses, or host-pathogen interactions, as many uncharacterized proteins in bacterial pathogens later prove important for survival or virulence .

What expression systems are optimal for producing recombinant SAHV_1560?

Based on available research, E. coli is the preferred expression system for recombinant SAHV_1560 production, offering advantages of rapid growth, high yields, and cost-effectiveness . For producing SAHV_1560, researchers should consider the following methodological approach:

Expression system selection and optimization:

  • E. coli expression: Most commonly used for S. aureus proteins, with BL21(DE3) or similar strains recommended for high-level expression .

  • Vector selection: pQE-30 or similar vectors with His-tag coding sequences allow for efficient purification through metal affinity chromatography .

  • Expression conditions:

    • Induction at OD600 of 0.6-0.8

    • IPTG concentration: 0.1-1.0 mM

    • Post-induction temperature: 16-30°C (lower temperatures may improve solubility)

    • Expression duration: 4-16 hours (optimization required)

  • Alternative systems: For challenging cases where E. coli expression results in insoluble or inactive protein, yeast expression systems (Pichia pastoris or Saccharomyces cerevisiae) might be considered, as demonstrated with other S. aureus proteins .

The choice between these systems should be guided by the research objectives, required protein folding, and downstream applications .

What purification strategies yield the highest quality recombinant SAHV_1560?

Purification of recombinant SAHV_1560 requires a multi-step approach to achieve high purity and biological activity. Based on documented methods for similar S. aureus proteins, the following strategy is recommended :

Purification protocol:

  • Cell lysis:

    • Chemical lysis using a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, and protease inhibitors

    • For membrane-associated proteins, include appropriate detergents (0.1-1% Triton X-100 or NP-40)

    • Sonication or high-pressure homogenization to disrupt cell membranes

  • Initial purification:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Stepwise imidazole gradient (10 mM for binding, 20-50 mM for washing, 250-500 mM for elution)

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and provide buffer exchange

    • Ion exchange chromatography if additional purity is required

  • Quality assessment:

    • SDS-PAGE with Coomassie staining (target >90% purity)

    • Western blot using anti-His antibodies

    • Mass spectrometry for identity confirmation

If the protein expresses as inclusion bodies, extraction under denaturing conditions (8M urea or 6M guanidine hydrochloride) followed by refolding may be necessary .

How should recombinant SAHV_1560 be stored to maintain stability?

Proper storage is critical for maintaining the stability and activity of recombinant SAHV_1560. Based on established protocols for similar proteins, the following storage conditions are recommended :

Storage guidelines:

  • Short-term storage (up to 1 week):

    • Store working aliquots at 4°C in buffer containing 50% glycerol

  • Medium-term storage (weeks to months):

    • Store at -20°C in Tris-based buffer with 50% glycerol

  • Long-term storage (months to years):

    • Store at -80°C in small aliquots (50-100 μL) to avoid repeated freeze-thaw cycles

  • Critical considerations:

    • Repeated freezing and thawing should be strictly avoided

    • Addition of stabilizing agents (glycerol, sucrose, or trehalose) at 10-50% can improve stability

    • Buffer pH should be optimized (typically pH 7.5-8.0)

    • Include reducing agents (DTT or β-mercaptoethanol) if the protein contains cysteine residues

Following these storage guidelines will help ensure protein integrity for downstream applications in research .

How can researchers design statistically sound experiments to investigate SAHV_1560's function?

Designing statistically rigorous experiments for investigating SAHV_1560's function requires careful consideration of several statistical principles. Based on established experimental design practices, researchers should implement the following approach :

Statistical design framework:

  • Sample size determination:

    • Conduct power analysis prior to experimentation

    • Consider the standardized effect size (R = |δ|/σ) when calculating required sample sizes

    • For detecting a difference of half a standard deviation with 80% power and 5% significance level, approximately 25 observations are needed

  • Experimental design principles:

    • Implement replication to assess variability and ensure reproducibility

    • Use randomization to minimize systematic bias

    • Consider blocking or grouping of subjects to control for confounding variables

    • Employ multifactorial design to investigate interactions between SAHV_1560 and other factors

  • Analysis planning:

    • Predefine primary and secondary endpoints

    • Select appropriate statistical tests based on data distribution

    • Plan for multiple comparison corrections if testing multiple hypotheses

Table 1: Sample size requirements based on standardized effect size (R) and desired power

Standardized Effect Size (R)Sample Size for 70% PowerSample Size for 80% PowerSample Size for 90% Power
0.3536994
0.5192535
0.881014
1.0579

These guidelines ensure experiments are adequately powered to detect biologically meaningful effects while minimizing false positives and negatives .

What are methodological approaches for investigating SAHV_1560's potential role in S. aureus pathogenesis?

Investigating SAHV_1560's role in S. aureus pathogenesis requires a multi-faceted approach combining molecular, cellular, and in vivo methodologies. The following experimental framework is recommended based on established approaches for studying virulence factors :

Methodological approach:

  • Gene expression analysis:

    • Quantify SAHV_1560 expression under various infection-relevant conditions (pH changes, oxidative stress, nutrient limitation)

    • Compare expression in clinical isolates with different virulence profiles

    • Analyze expression during different phases of infection using animal models

  • Gene knockout and complementation:

    • Generate SAHV_1560 deletion mutants using allelic exchange or CRISPR-Cas9

    • Create complemented strains to confirm phenotypic changes are due to SAHV_1560 deletion

    • Perform competitive infection assays between wild-type and mutant strains

  • Functional characterization:

    • Assess impact on biofilm formation, adherence to host cells, and persistence

    • Investigate interactions with host immune components

    • Determine localization during infection using immunofluorescence microscopy

    • Study protein-protein interactions using pull-down assays or bacterial two-hybrid systems

  • In vivo infection models:

    • Compare virulence of wild-type and SAHV_1560-deficient strains in appropriate animal models

    • Measure bacterial burden, dissemination, and host response parameters

    • Perform histopathological analyses of infected tissues

These approaches provide complementary data to elucidate SAHV_1560's contribution to S. aureus pathogenesis .

How can recombinant SAHV_1560 be used in vaccine development research?

Utilizing recombinant SAHV_1560 in vaccine development requires a systematic approach to epitope identification, immunogenicity assessment, and protective efficacy evaluation. Based on established methodologies for S. aureus vaccine research, the following framework is recommended :

Vaccine research methodology:

  • Epitope identification and selection:

    • Perform computational B-cell epitope prediction using algorithms like BepiPred, ABCpred, and Ellipro

    • Identify conserved regions across multiple S. aureus strains

    • Clone and express fragments containing predicted epitopes in E. coli with appropriate tags

  • Immunogenicity assessment:

    • Test reactivity of recombinant protein fragments with:

      • Hyperimmune sera against native S. aureus

      • Sera from patients/animals with confirmed S. aureus infections

      • Control sera from uninfected individuals

    • Evaluate both humoral and cellular immune responses in animal models

  • Protective efficacy evaluation:

    • Design randomized controlled animal trials with appropriate sample sizes

    • Include various formulations and adjuvants

    • Challenge with relevant S. aureus strains

    • Assess multiple outcome measures (bacterial burden, clinical signs, survival)

  • Combination approaches:

    • Evaluate SAHV_1560 in combination with other S. aureus antigens

    • Consider multiple antigen vaccine designs, as single-antigen approaches have historically shown limited efficacy against S. aureus

This methodological framework aligns with successful approaches used for other S. aureus proteins, such as AtlA, where recombinant proteins containing predicted B-cell epitopes demonstrated strong reactivity with sera from infected animals .

What are the key challenges in structural characterization of SAHV_1560 and how can they be addressed?

Structural characterization of SAHV_1560 presents several challenges typical of bacterial membrane-associated proteins. Based on approaches used for similar proteins, researchers should consider the following methodology :

Structural characterization approach:

  • Preliminary structure prediction:

    • Employ computational methods (AlphaFold2, I-TASSER, Rosetta)

    • Perform secondary structure prediction (PSIPRED, JPred)

    • Identify domains and conserved motifs using InterPro, SMART, and Pfam

  • Experimental structure determination strategies:

    • X-ray crystallography

      • Express protein constructs with terminal regions removed

      • Screen multiple crystallization conditions (sparse matrix approach)

      • Consider fusion partners (e.g., MBP, SUMO) to enhance solubility and crystallization

    • Cryo-electron microscopy

      • Particularly valuable if SAHV_1560 forms oligomeric assemblies

      • May require detergent screening to maintain native structure

    • Nuclear Magnetic Resonance (NMR)

      • Suitable for domains under 20 kDa

      • Requires isotope labeling (15N, 13C)

  • Alternative approaches:

    • Hydrogen-deuterium exchange mass spectrometry to probe solvent accessibility

    • Small-angle X-ray scattering (SAXS) for low-resolution envelope determination

    • Circular dichroism to assess secondary structure composition

  • Structure-function relationships:

    • Generate targeted mutations based on structural predictions

    • Assess impact on protein function, stability, and localization

    • Use crosslinking and mass spectrometry to identify interaction interfaces

These approaches can help overcome the challenges associated with structural characterization of potentially membrane-associated bacterial proteins like SAHV_1560 .

How can researchers investigate potential interactions between SAHV_1560 and the host immune system?

Investigating interactions between SAHV_1560 and host immunity requires a comprehensive approach spanning from molecular interactions to in vivo immune responses. Based on established methods for studying S. aureus immunobiology, the following methodology is recommended :

Immune interaction investigation approach:

  • Direct binding studies:

    • Screen for interactions with immune components using:

      • ELISA-based binding assays with purified immune factors

      • Surface plasmon resonance for kinetic analysis

      • Pull-down assays with host cell lysates followed by mass spectrometry

    • Investigate binding to pattern recognition receptors, complement components, and antibodies

  • Cellular immune responses:

    • Assess SAHV_1560 effects on:

      • Neutrophil recruitment, activation, and bacterial killing

      • Macrophage phagocytosis and cytokine production

      • Dendritic cell maturation and antigen presentation

    • Use flow cytometry, confocal microscopy, and cytokine assays to quantify responses

  • Adaptive immunity investigation:

    • Characterize antibody responses (isotype, affinity, neutralizing capacity)

    • Analyze T-cell responses (proliferation, cytokine profiles)

    • Assess memory B and T cell generation

  • In vivo immune modulation:

    • Compare wild-type and SAHV_1560-deficient S. aureus in:

      • Immunocompetent vs. immunodeficient animals

      • Animals with specific immune pathway deficiencies

    • Analyze immune cell infiltration and activation in infected tissues

S. aureus proteins often exhibit complex interactions with host immunity, including immune evasion functions that can be valuable for understanding pathogenesis and developing countermeasures .

What methodological approaches can help decipher SAHV_1560's potential role in antibiotic resistance?

Investigating SAHV_1560's potential involvement in antibiotic resistance requires a systematic approach combining phenotypic, genomic, and biochemical methods. The following framework addresses this advanced research question :

Antibiotic resistance investigation methodology:

  • Comparative expression analysis:

    • Quantify SAHV_1560 expression in:

      • Antibiotic-resistant vs. susceptible isogenic strains

      • Clinical isolates with varying resistance profiles

      • Cells exposed to sub-inhibitory antibiotic concentrations

    • Use qRT-PCR, RNA-seq, and proteomics for comprehensive analysis

  • Genetic manipulation studies:

    • Generate SAHV_1560 knockout, knockdown, and overexpression strains

    • Determine minimum inhibitory concentrations (MICs) for multiple antibiotic classes

    • Assess growth kinetics in the presence of antibiotics

    • Measure mutation frequencies and adaptation rates

  • Mechanistic investigations:

    • Analyze membrane permeability and efflux pump activity

    • Investigate cell wall synthesis and integrity

    • Assess oxidative stress responses and repair mechanisms

    • Examine protein synthesis and ribosome protection

  • Structural and interaction studies:

    • Identify potential physical interactions with known resistance determinants

    • Investigate structural similarities to characterized resistance factors

    • Perform co-immunoprecipitation to identify interaction partners

    • Use bacterial two-hybrid systems to verify specific interactions

This comprehensive approach can reveal whether SAHV_1560 directly contributes to antibiotic resistance or plays an accessory role in adaptation to antimicrobial pressure .

What are the most promising future research directions for SAHV_1560?

Based on current knowledge of S. aureus biology and the UPF0365 protein family, several high-priority research directions emerge for SAHV_1560:

  • Functional characterization:

    • Determine the protein's precise biological function through comprehensive knockout phenotyping

    • Investigate its potential role in membrane integrity, cell division, or environmental adaptation

  • Structural biology:

    • Solve the three-dimensional structure to inform structure-function relationships

    • Compare with other UPF0365 family members across bacterial species

  • Host-pathogen interactions:

    • Assess SAHV_1560's contribution to colonization and persistence

    • Investigate potential immunomodulatory properties

  • Therapeutic targeting:

    • Evaluate as a potential vaccine component or diagnostic marker

    • Assess as a drug target if essential for bacterial survival or virulence

  • Systems biology approaches:

    • Integrate SAHV_1560 into S. aureus protein interaction networks

    • Apply multi-omics studies to position SAHV_1560 within cellular pathways

These research directions would significantly advance understanding of this uncharacterized protein and potentially reveal new insights into S. aureus biology and pathogenesis .

How can researchers overcome technical challenges in working with SAHV_1560?

Researchers working with SAHV_1560 may encounter several technical challenges common to bacterial membrane-associated proteins. The following methodological solutions address these challenges:

Challenge resolution strategies:

  • Protein solubility issues:

    • Express as fusion proteins with solubility-enhancing tags (MBP, SUMO, Trx)

    • Optimize expression conditions (lower temperature, reduced inducer concentration)

    • Screen detergents for solubilization if membrane-associated

    • Consider cell-free expression systems

  • Purification difficulties:

    • Implement multi-step purification strategies

    • Use tandem affinity tags for enhanced purity

    • Consider on-column refolding for proteins expressed as inclusion bodies

    • Optimize buffer conditions based on stability testing

  • Functional assays:

    • Develop sensitive and specific assays based on predicted function

    • Use bacterial complementation systems to verify activity

    • Consider isothermal titration calorimetry for binding interactions

    • Implement high-throughput phenotypic screens

  • In vivo studies:

    • Design appropriate animal models reflecting human S. aureus infections

    • Consider tissue-specific or conditional knockout approaches

    • Implement bioluminescent imaging for real-time infection tracking

    • Use humanized mouse models for host-specific interactions

These methodological approaches can help overcome the technical challenges associated with studying uncharacterized bacterial proteins like SAHV_1560 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.