Staphylococcus aureus is a bacterium known to cause a range of infectious diseases, and frequently co-infects with other pathogens in different infectious diseases . The Staphylococcus aureus UPF0365 protein SAOUHSC_01676, also known as Flotillin-like protein FloA, is a protein expressed in E. coli . The protein, coded by gene SaurJH1_1665, has the UniProt ID A6U245 .
The amino acid sequence of the Recombinant Full Length Staphylococcus aureus Upf0365 Protein Saurjh1_1665 is :
MFSLSFIVIAVIIIVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP
LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE
AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS
TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA
DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY
NLKNIEADTGMRNAINKRTDQSDDESPEH
Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a significant role in maintaining membrane fluidity.
KEGG: sao:SAOUHSC_01676
STRING: 93061.SAOUHSC_01676
While the SAOUHSC_01676 protein is classified as part of the UPF0365 family (Uncharacterized Protein Family), comparative analysis suggests potential functional associations. The protein is also annotated as FloA (Flotillin-like protein A) in some databases, indicating a possible role in membrane organization and signaling processes . Bioinformatic analysis reveals the presence of several putative functional regions:
N-terminal transmembrane domain (residues 1-30)
Potential oligomerization domains in the central region
C-terminal region with charged residues suggesting interactions with other proteins
Advanced structural studies combining X-ray crystallography with molecular dynamics simulations would be necessary to fully characterize the functional domains of this protein .
Analyzing the membrane localization of SAOUHSC_01676 requires a multi-faceted approach:
Computational prediction: Begin with transmembrane prediction tools (TMHMM, Phobius) to identify potential membrane-spanning regions in the amino acid sequence (approximately residues 1-30).
Subcellular fractionation: Isolate membrane fractions from S. aureus or expression systems through differential centrifugation, followed by Western blotting using antibodies against SAOUHSC_01676 or its tag.
Fluorescence microscopy visualization: Create GFP fusion constructs and observe localization patterns in live cells. Comparison with known membrane markers can provide spatial resolution.
Protease accessibility assays: Determine membrane topology by exposing intact cells vs. spheroplasts to proteases, followed by protein detection to establish which regions are protected.
For advanced analysis, incorporate FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility within the membrane, which provides insights into functional interactions and complex formation .
| Expression System | Advantages | Limitations | Best For |
|---|---|---|---|
| E. coli | High yield, cost-effective, rapid growth | Limited post-translational modifications | Structural studies, antibody production |
| Yeast | Eukaryotic post-translational modifications | Lower yield than E. coli | Functional studies requiring modifications |
| Baculovirus/Insect Cells | Complex eukaryotic modifications, high expression | Technical complexity, higher cost | Complex functional studies |
| Mammalian Cells | Native-like folding and modifications | Highest cost, lowest yield | Highly sensitive functional assays |
When working with membrane-associated proteins like SAOUHSC_01676, E. coli strains optimized for membrane protein expression (C41/C43) should be considered to improve folding and yield .
A robust purification strategy for SAOUHSC_01676 should address its membrane association properties while maximizing yield and purity. The following step-wise procedure is recommended:
Expression optimization: Express the His-tagged protein in E. coli using auto-induction media at lower temperatures (16-18°C) to improve folding.
Cell lysis and solubilization: Use mild detergents (DDM, LDAO) in the lysis buffer to solubilize the membrane-associated protein without denaturing it.
Primary purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with gradient elution (50-300 mM imidazole).
Secondary purification: Size exclusion chromatography to separate monomeric protein from aggregates and remove residual contaminants.
Quality control: Assess purity by SDS-PAGE (>90% purity standard) and verify identity through Western blotting and mass spectrometry.
For membrane protein studies, consider incorporating amphipols or nanodiscs during the purification process to maintain native-like environments and improve stability .
When experiencing low expression yields of SAOUHSC_01676, implement a systematic troubleshooting approach:
Codon optimization: Analyze the codon usage of the SAOUHSC_01676 gene in your expression system. S. aureus has a different codon bias compared to E. coli, which may affect translation efficiency. Consider synthesizing a codon-optimized gene for your expression host.
Expression conditions matrix:
Test multiple induction temperatures (18°C, 25°C, 30°C, 37°C)
Vary inducer concentrations (0.1 mM - 1.0 mM IPTG or equivalent)
Adjust induction timing (early-log to mid-log phase)
Test different media formulations (LB, TB, auto-induction)
Fusion tag screening: If the standard His-tag approach yields poor results, screen alternative fusion partners:
Solubility enhancers (MBP, SUMO, TRX)
Alternative affinity tags (GST, FLAG, Strep)
Host strain evaluation: Test specialized E. coli strains:
BL21(DE3)pLysS for toxic protein control
Rosetta for rare codon supplementation
C41/C43 for membrane protein expression
Protein stability assessment: Add protease inhibitors throughout the process and analyze samples from multiple timepoints to identify potential degradation issues .
The SAOUHSC_01676 protein, also known as FloA (Flotillin-like protein A), is believed to play roles in membrane organization and potentially in bacterial virulence, though detailed characterization remains limited. Based on homology studies and preliminary functional analyses:
Membrane microdomain organization: Like eukaryotic flotillins, SAOUHSC_01676 likely participates in organizing functional membrane microdomains that serve as platforms for protein complexes.
Signal transduction: There is evidence suggesting association with two-component systems such as SaeRS, which regulates virulence factor expression in S. aureus. This relationship indicates potential involvement in sensing environmental signals and transducing them into cellular responses .
Biofilm formation: Preliminary studies indicate potential roles in biofilm development and maintenance, possibly through influencing cell-cell adhesion and extracellular matrix interactions.
Stress response: Expression patterns suggest upregulation during certain stress conditions, indicating potential roles in adaptive responses to environmental challenges.
Further functional characterization through gene deletion, complementation studies, and protein interaction analyses would provide deeper insights into its physiological role .
The interaction between SAOUHSC_01676 and the SaeRS two-component system represents an intriguing area of research with implications for S. aureus virulence regulation. Though not fully characterized, several methodological approaches can elucidate this relationship:
Co-immunoprecipitation (Co-IP): Using antibodies against SAOUHSC_01676 or SaeRS components (SaeR/SaeS) to pull down protein complexes, followed by Western blotting or mass spectrometry to identify interacting partners.
Bacterial two-hybrid assays: Employing split-reporter systems to detect direct protein-protein interactions between SAOUHSC_01676 and SaeR or SaeS in vivo.
Fluorescence microscopy co-localization: Creating fluorescently tagged versions of both proteins to visualize their spatial relationship within bacterial cells under various conditions.
Transcriptional reporter assays: Measuring the activity of SaeRS-dependent promoters (such as Phla) in wildtype versus SAOUHSC_01676 deletion mutants to assess functional impact.
Current data suggests that SAOUHSC_01676 may influence SaeRS activity by:
Facilitating the localization of SaeS within the membrane
Modulating the interaction between SaeS and SaeR
Affecting the phosphorylation state of SaeR, particularly in response to zinc availability and calprotectin sensing .
To investigate the potential role of SAOUHSC_01676 in S. aureus virulence, a comprehensive experimental framework combining molecular, cellular, and in vivo approaches is recommended:
Genetic manipulation studies:
Create clean gene deletion mutants (ΔSAOUHSC_01676)
Develop complementation strains with controlled expression
Engineer point mutations in key functional domains
Construct reporter fusions to monitor expression patterns
Virulence factor assessment:
Quantify hemolysis, coagulase, and protease activities
Measure toxin production using ELISA or Western blotting
Analyze secretome differences using proteomics
Monitor expression of virulence genes using qRT-PCR
Infection models:
Cell culture invasion and persistence assays
Whole blood survival tests
Invertebrate infection models (Galleria mellonella)
Mammalian infection models (murine abscess, sepsis)
Host-pathogen interaction studies:
Neutrophil killing resistance
Macrophage intracellular survival
Complement resistance assays
Immune cell activation measurements
Mechanistic investigations:
The optimal storage conditions for maintaining SAOUHSC_01676 stability are critical for preserving protein activity and structural integrity. According to product specifications:
Long-term storage: Store the lyophilized protein at -20°C to -80°C. The lower temperature (-80°C) is preferable for extended storage periods (>6 months) .
Working aliquots: Store reconstituted protein aliquots at 4°C for up to one week. Avoid repeated freeze-thaw cycles as they significantly reduce protein stability and activity .
Buffer composition: The recommended storage buffer consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0. For reconstituted protein, adding glycerol to a final concentration of 50% helps maintain stability during freeze-thaw transitions .
Reconstitution protocol:
For projects requiring prolonged use, stability can be further enhanced by adding reducing agents (1-5 mM DTT) or protease inhibitors to prevent oxidation and degradation.
Monitoring the structural integrity of SAOUHSC_01676 after purification and storage is essential to ensure experimental reproducibility. A multi-technique approach provides comprehensive assessment:
SDS-PAGE and Western blotting:
Immediately after purification (baseline)
After various storage periods
Compare band patterns to detect degradation
Look for shifts in molecular weight or additional bands
Circular Dichroism (CD) spectroscopy:
Measure secondary structure content
Compare fresh vs. stored samples for conformational changes
Monitor thermal stability through melting curves
Size Exclusion Chromatography (SEC):
Assess aggregation state and oligomerization
Monitor shifts in elution profiles after storage
Quantify monomer to aggregate ratios
Dynamic Light Scattering (DLS):
Measure particle size distribution
Track changes indicating aggregation
Monitor polydispersity as a quality indicator
Functional activity assays:
Develop binding assays to known interactors
Compare activity between fresh and stored samples
Establish minimum activity thresholds for experimental use
Performing these analyses at regular intervals (freshly prepared, 1 week, 1 month, 3 months) provides valuable stability data to optimize storage conditions for specific experimental requirements .
SAOUHSC_01676 (FloA) presents a valuable tool for investigating bacterial membrane organization, particularly the formation and function of membrane microdomains in S. aureus. Researchers can implement several approaches:
Fluorescent protein fusions:
Create N- or C-terminal fusions with fluorescent proteins (GFP, mCherry)
Visualize distribution patterns using super-resolution microscopy (STORM, PALM)
Perform time-lapse imaging to track dynamic reorganization under different conditions
Membrane proteomics:
Use SAOUHSC_01676 as a bait protein in proximity labeling experiments (BioID, APEX)
Identify co-localizing proteins through quantitative proteomics
Map the composition of SAOUHSC_01676-associated membrane domains
Lipid interaction studies:
Analyze lipid preferences through lipidomics of isolated membrane fractions
Reconstitute purified protein in model membranes with defined compositions
Examine effects on membrane fluidity and organization using fluorescent probes
Bacterial two-component system interactions:
These approaches can reveal fundamental principles of bacterial membrane organization and provide insights into potential targets for antimicrobial development.
Developing effective antibodies against SAOUHSC_01676 requires careful consideration of several factors to ensure specificity, sensitivity, and experimental utility:
Antigen design strategies:
Full-length protein: Provides comprehensive epitope coverage but may present solubility challenges
Peptide-based: Select unique, surface-exposed regions (typically 15-20 amino acids)
Domain-specific: Target conserved functional domains for cross-species reactivity
Immunization considerations:
Animal selection: Rabbits typically provide high-affinity polyclonal responses
Adjuvant selection: Balance immunogenicity with minimal non-specific stimulation
Immunization schedule: Primary plus 3-4 boosters over 2-3 months
Antibody validation matrix:
| Validation Method | Purpose | Controls |
|---|---|---|
| Western Blotting | Confirm size specificity | Recombinant protein, S. aureus lysates, ΔSAOUHSC_01676 strain |
| Immunoprecipitation | Verify native recognition | Pre-immune serum, isotype controls |
| Immunofluorescence | Assess cellular localization | Peptide competition, ΔSAOUHSC_01676 strain |
| ELISA | Quantify sensitivity/specificity | Cross-reactivity panel with related proteins |
Special considerations for membrane proteins:
Use native conformation-preserving detergents during immunization
Consider whole-cell immunization for surface-exposed epitopes
Develop antibodies against both extracellular and intracellular domains
Purified recombinant His-tagged SAOUHSC_01676 (>90% purity) serves as an excellent immunogen and can also be used for antibody purification through affinity chromatography .
Investigating potential connections between SAOUHSC_01676 and antibiotic resistance mechanisms requires a systematic research approach:
Comparative expression analysis:
Measure SAOUHSC_01676 expression levels in susceptible vs. resistant S. aureus strains
Monitor expression changes following sub-inhibitory antibiotic exposure
Perform RNA-seq to identify co-regulated genes in resistance pathways
Genetic manipulation experiments:
Create SAOUHSC_01676 deletion and overexpression strains
Determine minimum inhibitory concentrations (MICs) for various antibiotics
Assess changes in resistance acquisition rates under selective pressure
Membrane permeability studies:
Measure uptake of fluorescent dyes (propidium iodide, ethidium bromide)
Quantify antibiotic accumulation in wildtype vs. mutant strains
Analyze membrane fluidity and rigidity parameters
Protein interaction investigations:
Identify interactions with known resistance determinants (PBPs, efflux pumps)
Examine co-localization with antibiotic targets using fluorescence microscopy
Perform pull-down assays to isolate SAOUHSC_01676-associated protein complexes
In vivo infection models:
Compare treatment efficacy in infections with wildtype vs. mutant strains
Assess bacterial persistence following antibiotic treatment
Monitor resistance development during therapeutic regimens
This multi-faceted approach can reveal whether SAOUHSC_01676's membrane organization functions contribute to intrinsic or acquired resistance mechanisms in S. aureus .
Investigating SAOUHSC_01676's role in biofilm formation and persistence requires a comprehensive experimental approach:
Biofilm formation assessment:
Compare wildtype, deletion, and complemented strains using crystal violet assays
Analyze biofilm structure through confocal microscopy and 3D reconstruction
Measure extracellular matrix production (polysaccharides, eDNA, proteins)
Evaluate cell-cell adhesion properties and surface attachment capabilities
Environmental response studies:
Examine biofilm development under different stressors (antibiotics, pH, osmolarity)
Monitor SAOUHSC_01676 expression throughout biofilm maturation using reporter fusions
Assess protein localization patterns in planktonic versus biofilm states
Molecular mechanism investigations:
Analyze interaction with known biofilm regulators (SarA, Agr, Sae)
Identify changes in gene expression profiles between wildtype and mutant biofilms
Investigate co-localization with adhesins and other surface proteins
Persistence and dispersal dynamics:
Evaluate susceptibility of mature biofilms to antimicrobial challenges
Measure persistence rates following antibiotic treatment
Analyze dispersal mechanisms and the role of SAOUHSC_01676 in this process
Current hypotheses suggest SAOUHSC_01676 may influence biofilm development through:
Organization of membrane microdomains that coordinate adhesin presentation
Modulation of two-component system signaling that regulates biofilm-associated genes
Facilitation of cell-cell communication through membrane organization
Coordination of stress responses that promote biofilm persistence
To comprehensively characterize the structure-function relationship of SAOUHSC_01676, a multi-disciplinary experimental design is optimal:
High-resolution structural determination:
X-ray crystallography of purified protein (challenging for membrane proteins)
Cryo-electron microscopy to visualize membrane-associated conformations
NMR spectroscopy for dynamic regions and ligand interactions
Molecular dynamics simulations to model membrane integration
Domain mapping through targeted mutagenesis:
Alanine-scanning mutagenesis of conserved residues
Domain deletion/swap experiments with related proteins
Site-directed mutagenesis of predicted functional motifs
Creation of chimeric proteins to identify specificity determinants
Proposed Mutant Library:
| Mutation Type | Target Region | Expected Impact | Validation Assays |
|---|---|---|---|
| Transmembrane disruption | Residues 1-30 | Altered membrane localization | Microscopy, fractionation |
| Oligomerization interface | Central region | Defective complex formation | SEC-MALS, native PAGE |
| C-terminal truncations | Residues 280-329 | Impaired protein interactions | Pull-down, Y2H |
| Conserved motif mutations | Various | Function-specific defects | Reporter assays, phenotyping |
Structure-guided functional assays:
Membrane localization studies with fluorescent protein fusions
Protein interaction analyses with predicted partners
Assessment of oligomerization states under various conditions
Correlation of structural features with phenotypic outcomes
Comparative analysis across species:
Identify conservation patterns in UPF0365 family proteins
Perform complementation studies with homologs from other bacteria
Map species-specific versus conserved functional elements
This integrated approach would connect structural features to specific cellular functions and provide mechanistic insights into SAOUHSC_01676's role in S. aureus biology .
Systems biology approaches offer powerful frameworks to contextualize SAOUHSC_01676 within the complex regulatory landscape of S. aureus:
Multi-omics integration:
Transcriptomics: RNA-seq comparing wildtype vs. SAOUHSC_01676 mutants under various conditions
Proteomics: Quantitative analysis of protein abundance changes and post-translational modifications
Metabolomics: Identification of metabolic pathway alterations resulting from SAOUHSC_01676 disruption
Interactomics: Comprehensive protein interaction mapping using AP-MS or BioID approaches
Network reconstruction and analysis:
Generate protein-protein interaction networks centered on SAOUHSC_01676
Construct regulatory networks incorporating transcription factors and two-component systems
Develop predictive models of information flow through these networks
Identify network motifs and regulatory hubs connected to SAOUHSC_01676
Perturbation studies:
Systematic combinatorial gene deletions with SAOUHSC_01676 and potential interactors
Chemical genomics screens to identify synthetic interactions
Environmental stress response profiling across genetic backgrounds
Time-resolved analyses of network dynamics following stimulation
Computational modeling:
Develop ordinary differential equation models of SAOUHSC_01676-influenced pathways
Perform constraint-based modeling to predict metabolic impacts
Implement machine learning approaches to identify emergent patterns
Create predictive models of virulence and antibiotic resistance based on network states
These approaches would position SAOUHSC_01676 within the broader context of S. aureus biology, potentially revealing unexpected connections to virulence regulation, stress responses, and bacterial adaptation mechanisms .
Based on current knowledge and technological capabilities, several research directions show particular promise for elucidating SAOUHSC_01676 function:
Structural biology approaches: High-resolution structures through cryo-EM or X-ray crystallography would provide crucial insights into how this protein organizes within the membrane and interacts with partners. These structural details could inform targeted mutagenesis studies to dissect specific functional domains.
Membrane microdomain characterization: Advanced imaging techniques like super-resolution microscopy combined with specific lipid probes could reveal how SAOUHSC_01676 organizes membrane domains in S. aureus. These studies would benefit from correlative light and electron microscopy approaches to connect protein localization with membrane ultrastructure.
Interactome mapping: Comprehensive identification of SAOUHSC_01676 protein interaction networks across different environmental conditions would place this protein within cellular pathways. Techniques like BioID, proximity labeling, or cross-linking mass spectrometry offer promising approaches for capturing both stable and transient interactions.
In vivo infection models: Evaluating the contribution of SAOUHSC_01676 to S. aureus pathogenesis in relevant animal models would connect molecular mechanisms to disease outcomes. These studies should incorporate tissue-specific analyses and immune response measurements.
Two-component system integration: Detailed investigation of how SAOUHSC_01676 interfaces with the SaeRS and other two-component systems would reveal its role in signal transduction networks that control virulence and adaptation .
Research on SAOUHSC_01676 could potentially inform novel antimicrobial strategies through several mechanisms:
Membrane organization disruption: If SAOUHSC_01676 plays a critical role in organizing functional membrane microdomains, compounds that disrupt this organization could compromise bacterial survival or virulence. Small molecules targeting protein-lipid or protein-protein interactions involved in microdomain assembly represent a novel class of antimicrobial agents.
Virulence attenuation: Rather than killing bacteria directly, targeting SAOUHSC_01676 could potentially attenuate virulence by disrupting regulatory networks that control toxin production and immune evasion mechanisms. This approach might reduce selection pressure for resistance compared to conventional antibiotics.
Combination therapy enhancement: Inhibitors targeting SAOUHSC_01676 might sensitize S. aureus to existing antibiotics by altering membrane permeability or efflux pump organization. Identifying such synergistic interactions could revitalize currently ineffective antimicrobials.
Biofilm prevention and disruption: If SAOUHSC_01676 contributes to biofilm formation or maintenance, targeting this protein could enhance biofilm penetration by antibiotics or directly prevent the establishment of these resistant communities.
Diagnostic and monitoring applications: Understanding SAOUHSC_01676 expression patterns during infection could enable the development of diagnostic tools that predict antibiotic response or disease progression.
To advance these possibilities, high-throughput screening for inhibitors combined with detailed mechanism-of-action studies would be essential to translate basic research findings into therapeutic applications .
Studying SAOUHSC_01676 presents several technical challenges common to membrane protein research, along with specific difficulties related to S. aureus biology:
Membrane protein solubility and stability:
Challenge: Maintaining native conformation during extraction and purification
Solutions:
Employ gentle detergents (DDM, LMNG) or styrene-maleic acid copolymers (SMAs)
Utilize nanodiscs or amphipols to provide membrane-like environments
Develop on-membrane structural analysis techniques like solid-state NMR
S. aureus genetic manipulation:
Challenge: Lower transformation efficiency and homologous recombination rates
Solutions:
Optimize electroporation protocols with glycine treatment and wall-weakening agents
Employ CRISPR-Cas9 systems adapted for S. aureus
Utilize temperature-sensitive plasmids for chromosomal integration
Functional redundancy:
Challenge: Potential compensation by related proteins masking phenotypes
Solutions:
Generate multiple deletion strains targeting related proteins
Employ inducible degradation systems for acute protein depletion
Utilize quantitative approaches sensitive to subtle phenotypic changes
Complex membrane microdomain visualization:
Challenge: Resolution limitations in bacteria due to small size
Solutions:
Apply expansion microscopy techniques to increase effective resolution
Utilize correlative light and electron microscopy approaches
Develop proximity labeling methods specific for membrane domains
Translation to in vivo relevance:
Challenge: Connecting molecular mechanisms to infection outcomes
Solutions:
Develop tissue-specific infection models
Employ dual RNA-seq to capture host-pathogen interactions
Create reporter strains for in vivo imaging of protein activity