Recombinant Staphylococcus aureus UPF0365 protein SAR1650 (SAR1650)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; SAR1650; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Staphylococcus aureus (strain MRSA252)
Target Names
SAR1650
Target Protein Sequence
MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH
Uniprot No.

Target Background

Function
Recombinant Staphylococcus aureus UPF0365 protein SAR1650 (SAR1650) is found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs are highly dynamic and increase in number with cellular aging. Flotillins are believed to play a significant role in maintaining membrane fluidity.
Database Links

KEGG: sar:SAR1650

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant SAR1650?

Several expression systems can be employed for producing recombinant SAR1650, each with distinct advantages depending on your research objectives:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliHigh yield, cost-effective, rapid productionPotential issues with protein folding, may lack post-translational modifications10-50 mg/L
YeastBetter protein folding, some post-translational modificationsLonger production time than E. coli5-20 mg/L
BaculovirusComplex eukaryotic modifications, good for structural studiesMore expensive, technically demanding1-10 mg/L
Mammalian CellsMost authentic post-translational modificationsHighest cost, longest production time0.5-5 mg/L

The most commonly reported system for SAR1650 expression is E. coli, where the protein is typically fused to an N-terminal His-tag to facilitate purification . When selecting an expression system, consider your downstream applications and whether post-translational modifications are critical for your research goals .

How should I design experiments to study SAR1650 function in Staphylococcus aureus?

Designing robust experiments to study SAR1650 function requires a systematic approach that incorporates proper controls and accounts for potential confounding variables. Consider the following framework:

  • Hypothesis formulation: Develop a specific, testable hypothesis about SAR1650's function based on its sequence, predicted structure, or homology to other proteins .

  • Variable definition:

    • Independent variable: Manipulation of SAR1650 (e.g., knockout, overexpression, site-directed mutagenesis)

    • Dependent variable: Measurable outcomes (e.g., bacterial growth rate, membrane integrity, virulence)

    • Controlled variables: Growth conditions, bacterial strain background, etc.

  • Experimental approaches:

    • Loss-of-function: Generate SAR1650 deletion mutants using CRISPR-Cas9 or homologous recombination

    • Gain-of-function: Express SAR1650 in trans from a plasmid under inducible promoters

    • Structure-function: Create point mutations in key domains to assess their contribution

  • Controls:

    • Positive control: Known functional homolog or complemented mutant

    • Negative control: Empty vector or unrelated protein expression

    • Wild-type control: Parental MRSA252 strain

  • Replication strategy: Implement biological replicates (minimum n=3) and technical replicates to ensure statistical power .

A key consideration is avoiding pseudoreplication by ensuring that the experimental unit matches the unit of statistical analysis. For SAR1650 studies, this means using independent bacterial cultures rather than multiple samples from the same culture .

What are the critical considerations when designing a recombinant vector containing SAR1650?

When designing a recombinant vector containing SAR1650, several critical factors must be considered to ensure successful expression and functionality:

  • Codon optimization: Analyze the codon usage bias of your expression host and optimize the SAR1650 sequence accordingly, particularly if expressing in eukaryotic systems.

  • Fusion tags selection: Consider the impact of different tags on protein solubility, detection, and purification:

    • His-tag: Most commonly used for SAR1650, enables IMAC purification

    • HA or c-Myc tags: Useful for detection via Western blot

    • GST or MBP: May enhance solubility but add significant size

  • Vector backbone selection: Choose based on your expression system and needs:

    • pcDNA3.1+ has been successfully used for mammalian expression of similar recombinant proteins

    • pET series vectors are common for E. coli expression

  • Regulatory elements: Select appropriate promoters, enhancers, and terminators compatible with your expression system.

  • Cloning strategy: Design restriction sites or use Gateway/Gibson assembly methods that allow in-frame insertion while preserving critical domains.

An integrated in silico and experimental approach is recommended to optimize vector design. As demonstrated in related research, molecular modeling and docking studies prior to plasmid construction can significantly improve expression outcomes and reduce experimental iterations .

What purification methods are most effective for recombinant SAR1650?

Purification of recombinant SAR1650 requires a tailored approach based on the expression system and fusion tags used. The following sequential purification strategy is recommended:

  • Initial clarification: Following cell lysis (sonication for E. coli or gentle detergent lysis for mammalian cells), centrifuge at 15,000 × g for 30 minutes to remove cell debris.

  • Affinity chromatography: For His-tagged SAR1650, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is the primary purification step:

    • Bind: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Wash: Same buffer with 20-30 mM imidazole

    • Elute: Same buffer with 250-300 mM imidazole gradient

  • Secondary purification: Size exclusion chromatography (SEC) using a Superdex 75 or 200 column in PBS or Tris buffer to remove aggregates and achieve >90% purity.

  • Concentration and buffer exchange: Use centrifugal filter units (10-30 kDa MWCO) to concentrate and exchange into a storage buffer (typically Tris/PBS-based buffer with 6% trehalose, pH 8.0) .

  • Quality control: Assess purity by SDS-PAGE (should exceed 90%) and confirm identity by Western blot or mass spectrometry .

For membrane proteins like SAR1650, addition of mild detergents (0.05% DDM or 0.1% Triton X-100) to all buffers may improve solubility and prevent aggregation during purification steps.

How should recombinant SAR1650 be stored to maintain stability and activity?

Proper storage of recombinant SAR1650 is critical to maintain its stability and biological activity. Based on empirical data from similar proteins, the following storage recommendations are provided:

  • Short-term storage (1-2 weeks):

    • Store at 4°C in Tris/PBS-based buffer (pH 8.0) with 6% trehalose

    • Avoid repeated freeze-thaw cycles

    • Include protease inhibitors if concerned about degradation

  • Long-term storage (months to years):

    • Store at -20°C or preferably -80°C

    • Aliquot in small volumes to avoid repeated freeze-thaw cycles

    • Add stabilizing agents: 25-50% glycerol (final concentration)

  • Lyophilization option: For extended stability, lyophilized powder can be stored at -20°C with minimal activity loss

  • Reconstitution protocol:

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for frozen storage

    • Allow complete solubilization before use or further dilution

Stability studies indicate that recombinant SAR1650 can maintain >90% activity for at least 6 months when stored at -80°C in aliquots with 50% glycerol. Working aliquots stored at 4°C typically maintain activity for approximately one week .

How can molecular docking approaches be used to study SAR1650 interactions?

Molecular docking is a powerful approach to investigate SAR1650's potential interactions with other proteins, ligands, or membrane components. The following methodology has been validated for similar membrane-associated proteins:

  • Preparation of SAR1650 structure:

    • If crystal structure is unavailable, generate a homology model using SWISS-MODEL or I-TASSER

    • Refine the model using molecular dynamics simulations in a membrane environment

    • Evaluate model quality using PROCHECK and ERRAT

  • Identification of potential binding sites:

    • Analyze surface topology using CASTp or SiteMap

    • Predict functional regions through conserved domain analysis

    • Consider membrane-embedded regions and solvent-accessible domains separately

  • Docking protocol using HADDOCK:

    • Define ambiguous interaction restraints (AIRs) based on predicted active residues

    • For SAR1650, focus on regions close to the transmembrane domain (e.g., PHE20-TRP25, ALA1-ILE29, ARG8-LEU16)

    • Begin with rigid body energy minimization (1000 solutions)

    • Perform semi-rigid simulated annealing (200 solutions)

    • Conduct final refinement in Cartesian space with explicit solvent (200 solutions)

  • Analysis of docking results:

    • Cluster solutions based on RMSD

    • Evaluate binding energy scores

    • Analyze specific residue interactions

    • Validate top models with experimental approaches

This integrated computational-experimental approach has successfully identified interaction partners for similar proteins and can help generate testable hypotheses about SAR1650 function in the bacterial membrane .

What are the considerations for studying the role of SAR1650 in Staphylococcus aureus pathogenesis?

Investigating SAR1650's role in S. aureus pathogenesis requires a multifaceted approach that considers both bacterial physiology and host-pathogen interactions:

  • In vitro virulence assays:

    • Compare wild-type and SAR1650 mutant strains for:

      • Biofilm formation capacity

      • Resistance to antimicrobials

      • Growth kinetics under stress conditions

      • Membrane integrity and permeability

      • Production of virulence factors (toxins, adhesins)

  • Cell culture infection models:

    • Assess invasion and intracellular survival in relevant host cell types

    • Measure cytotoxicity and inflammatory responses

    • Evaluate immune cell activation and bacterial killing

  • Advanced experimental design considerations:

    • Implement time-series experiments to track temporal changes in bacterial behavior

    • Use multiple strain backgrounds to account for genetic variability

    • Consider factorial designs to examine interactions between SAR1650 and other virulence determinants

  • In vivo infection models:

    • Select appropriate animal models based on the aspect of pathogenesis under study

    • Design experiments with adequate controls and sample sizes for statistical power

    • Measure multiple outcomes (bacterial burden, histopathology, immune responses)

  • Controlling confounding variables:

    • Batch effects can significantly impact results, particularly in multi-day experiments

    • Implement randomization and blocking designs to minimize confounding

    • Process samples in balanced batches that include both experimental and control groups

When designing these experiments, consider both internal validity (causation within the experimental system) and external validity (generalizability to clinical scenarios) .

How should contradictory results in SAR1650 functional studies be interpreted?

Contradictory results are common in complex biological systems and particularly when studying multifunctional proteins like SAR1650. A systematic approach to resolving such contradictions includes:

  • Methodological comparison:

    • Examine differences in experimental conditions (media, growth phase, temperature)

    • Compare genetic backgrounds of bacterial strains used

    • Assess differences in recombinant protein preparation (tags, expression systems)

    • Evaluate measurement techniques and their sensitivity/specificity

  • Statistical reassessment:

    • Review statistical power - underpowered studies may yield false negatives

    • Examine effect sizes rather than just p-values

    • Consider multiple testing corrections if applicable

    • Evaluate whether appropriate statistical tests were used

  • Alternative hypotheses exploration:

    • Consider context-dependent functions of SAR1650

    • Investigate potential compensatory mechanisms in knockout models

    • Assess whether contradictions represent real biological complexity rather than experimental artifacts

  • Integrated data analysis approaches:

    • Implement meta-analysis techniques if multiple studies exist

    • Consider Bayesian approaches to incorporate prior information

    • Use computational modeling to reconcile apparently contradictory observations

  • Validation experiments design:

    • Design crucial experiments that directly address the contradiction

    • Include appropriate positive and negative controls

    • Use orthogonal methods to measure the same biological outcome

    • Consider single-subject experimental designs for highly variable systems

When reporting contradictory findings, present all evidence transparently and distinguish between what is conclusively known, what is suggested by data, and what remains uncertain about SAR1650 function.

What are the best practices for analyzing protein-protein interaction data involving SAR1650?

Analyzing protein-protein interaction (PPI) data for SAR1650 requires rigorous validation and careful interpretation. The following best practices are recommended:

  • Data quality assessment:

    • Evaluate signal-to-noise ratios in primary data

    • Assess reproducibility across biological and technical replicates

    • Identify and exclude common contaminants and non-specific binders

    • Apply appropriate normalization methods to account for expression level differences

  • Validation through orthogonal methods:

    • Confirm key interactions using at least two independent techniques:

      • Co-immunoprecipitation followed by Western blot

      • Proximity labeling methods (BioID, APEX)

      • FRET or BRET for in vivo interactions

      • Surface plasmon resonance for quantitative binding parameters

  • Network analysis approaches:

    • Construct interaction networks using specialized software (Cytoscape, STRING)

    • Identify highly connected nodes and interaction modules

    • Perform GO term enrichment analysis on interacting partners

    • Compare with known protein complexes and pathways

  • Structural context integration:

    • Map interactions to specific domains or motifs of SAR1650

    • Assess the structural compatibility of proposed interactions

    • Use molecular docking to generate structural models of key interactions

    • Validate interaction interfaces through mutagenesis studies

  • Functional relevance assessment:

    • Determine whether interactions occur under physiologically relevant conditions

    • Assess co-expression patterns and cellular co-localization

    • Evaluate phenotypic consequences of disrupting specific interactions

    • Consider the dynamic nature of interactions across different cellular states

For membrane proteins like SAR1650, special consideration should be given to the detergents and solubilization methods used, as these can dramatically affect the detected interaction landscape and lead to both false positives and false negatives.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.