Recombinant Staphylococcus aureus UPF0365 protein SAUSA300_1533 (SAUSA300_1533)

What is SAUSA300_1533 and what are its key characteristics?

SAUSA300_1533 is an UPF0365 family protein from Staphylococcus aureus strain USA300, a prevalent methicillin-resistant S. aureus (MRSA) strain. The full-length protein consists of 329 amino acids with the sequence beginning with MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAA and continuing through to its C-terminus . This protein contains transmembrane domains as evidenced by its hydrophobic N-terminal region, suggesting it may be membrane-associated. The protein is assigned to the UPF0365 family, a group of proteins with conserved structure but not yet fully characterized function in bacterial physiology .

How should recombinant SAUSA300_1533 protein be stored for optimal stability?

Recombinant SAUSA300_1533 protein should be stored at -20°C for routine storage, and at -80°C for extended storage periods to maintain protein integrity and activity . The protein is typically provided in a Tris-based buffer containing 50% glycerol, which has been optimized to maintain protein stability . It's recommended to avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of activity. For ongoing experiments, working aliquots can be stored at 4°C for up to one week . When handling the lyophilized form of the protein, it's important to reconstitute it properly according to recommended protocols to ensure proper folding and activity .

How can cell-selective BONCAT be applied to study SAUSA300_1533 expression during infection?

Cell-selective Bio-orthogonal Non-Canonical Amino Acid Tagging (BONCAT) represents a powerful approach to selectively study SAUSA300_1533 expression during infection. This technique enables temporal labeling of newly synthesized proteins using non-canonical amino acids that can be subsequently detected and identified . To implement this for SAUSA300_1533 studies, researchers would first engineer S. aureus to express a modified methionyl-tRNA synthetase (MetRS) variant that can incorporate azidonorleucine (Anl) into newly synthesized proteins . During infection studies, Anl would be added to the system, allowing selective incorporation into bacterial proteins while host proteins remain unlabeled.

After infection, bacterial proteins containing Anl, including SAUSA300_1533 if it's being expressed, can be selectively enriched through click chemistry reactions and identified using mass spectrometry . This approach has been successfully applied to identify proteins synthesized by methicillin-resistant S. aureus during mouse infection models, making it suitable for studying SAUSA300_1533 expression under physiologically relevant conditions . The advantage of this technique is that it provides temporal resolution of protein synthesis within the complex environment of host-pathogen interaction, whereas traditional proteomics approaches cannot distinguish newly synthesized proteins from pre-existing ones.

What role might SAUSA300_1533 play in S. aureus pathogenesis based on structural predictions?

Based on structural predictions and amino acid sequence analysis, SAUSA300_1533 likely functions as a membrane protein, given its highly hydrophobic N-terminal region (MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAA) consistent with transmembrane domains . The protein belongs to the UPF0365 family, which remains functionally uncharacterized but conserved across various bacterial species.

How can SAUSA300_1533 be visualized in infected tissues while maintaining spatial context?

Visualization of SAUSA300_1533 in infected tissues with preserved spatial context can be achieved by combining cell-selective BONCAT with microbial identification after passive clarity technique (MiPACT) . This integrated approach begins with infection using S. aureus strains engineered to express SAUSA300_1533 with an epitope tag or fluorescent protein fusion. Following infection, tissues are processed using the clarity technique, which renders them optically transparent while maintaining structural integrity.

The procedure involves:

• Infecting host tissues with engineered S. aureus expressing tagged SAUSA300_1533

• Fixing tissues with paraformaldehyde

• Embedding in hydrogel

• Clearing lipids using detergents

• Immunostaining for SAUSA300_1533 using antibodies against the epitope tag

• Counterstaining for host markers

• Imaging using confocal or light-sheet microscopy

This approach preserves the three-dimensional architecture of infected tissues and allows visualization of SAUSA300_1533 localization relative to host structures . The technique can reveal potential tropism of bacteria expressing this protein for specific tissue compartments and may indicate functional roles based on localization patterns. When combined with temporal studies, this method can track the expression dynamics of SAUSA300_1533 throughout the infection process.

What fusion tags are recommended for purification and functional studies of SAUSA300_1533?

Several fusion tags can be employed for SAUSA300_1533 purification and functional studies, each with distinct advantages depending on research objectives. The most commonly used tags include:

For SAUSA300_1533 specifically, the His tag is frequently employed as seen in commercially available constructs , providing good yields with minimal interference. The tag position also warrants consideration, with options for N-terminal or C-terminal placement depending on predicted functional domains . For membrane proteins like SAUSA300_1533, C-terminal tags often preserve functionality better than N-terminal tags, which might disrupt signal peptides or transmembrane domains. Ultimately, validation experiments comparing different tag configurations are recommended to ensure biological relevance.

What controls should be included when performing functional assays with SAUSA300_1533?

Robust functional assays for SAUSA300_1533 require comprehensive controls to ensure valid interpretation of results. Essential controls include:

• Expression Controls:

  • Western blot verification of SAUSA300_1533 expression

  • Quantification of expression levels across experimental conditions

  • Verification of subcellular localization

• Negative Controls:

  • Empty vector-transformed bacteria

  • Inactive mutant versions of SAUSA300_1533 (site-directed mutagenesis of predicted functional residues)

  • Unrelated protein of similar size and characteristics

• Positive Controls:

  • Known S. aureus virulence factors with established phenotypes

  • Complemented SAUSA300_1533 knockout strains

• Experimental Validation Controls:

  • Multiple independent bacterial clones

  • Biological replicates across different days

  • Technical replicates within experiments

  • Dose-response relationships where applicable

• Host Response Controls:

  • Uninfected host cells/tissues

  • Host cells treated with purified SAUSA300_1533 versus heat-inactivated protein

  • Host genetic knockouts of predicted interaction partners

When designing infection experiments, proper control of inoculum size, growth phase of bacteria, and host cell conditions are critical variables that require standardization . Additionally, time-course experiments should be performed to distinguish immediate versus delayed effects of SAUSA300_1533 expression.

How should knockout and complementation studies for SAUSA300_1533 be designed?

Designing effective knockout and complementation studies for SAUSA300_1533 requires careful consideration of genetic approaches and validation strategies:

Knockout Strategy:

• Generate a clean deletion mutant using allelic exchange with a suicide vector containing homology arms flanking SAUSA300_1533

• Alternatively, employ CRISPR-Cas9 approaches for precise gene editing

• Confirm deletion by PCR, sequencing, and Western blot analysis

• Check for polar effects on neighboring genes using RT-PCR

• Evaluate growth characteristics in standard laboratory media to detect general fitness defects

Complementation Approach:

• Clone the wild-type SAUSA300_1533 gene with its native promoter into a low or medium-copy plasmid

• Alternatively, use an inducible expression system for controlled complementation

• Include epitope tags that don't interfere with function for detection

• Verify expression levels relative to wild-type using qRT-PCR and Western blotting

• Include empty vector controls in all experiments

Phenotypic Assessment:

• Compare wild-type, knockout, and complemented strains in both in vitro assays and infection models

• Utilize cell-selective BONCAT to identify proteins affected by SAUSA300_1533 deletion

• Assess virulence factor production, biofilm formation, and stress responses

• Evaluate host cell interactions using tissue culture infection models

• Conduct in vivo infection studies using appropriate animal models with proper controls

This comprehensive approach ensures that phenotypes attributed to SAUSA300_1533 are specific and can be directly linked to the protein's function rather than to polar effects or secondary mutations.

How should researchers analyze proteomic data to identify interaction partners of SAUSA300_1533?

Analyzing proteomic data to identify genuine interaction partners of SAUSA300_1533 requires a systematic approach combining experimental design, statistical analysis, and biological validation:

Experimental Design for Interactome Analysis:

• Perform co-immunoprecipitation with tagged SAUSA300_1533 as bait

• Include appropriate controls (tag-only, unrelated protein of similar size/localization)

• Use crosslinking approaches to capture transient interactions

• Consider BioID or proximity labeling approaches for in vivo interaction mapping

• Implement SILAC or TMT labeling for quantitative comparison

Statistical Analysis Pipeline:

• Filter raw mass spectrometry data using quality metrics (peptide confidence, protein coverage)

• Calculate enrichment ratios compared to control samples

• Apply statistical tests (t-test, ANOVA with proper multiple testing correction)

• Establish significance thresholds based on false discovery rate

• Generate volcano plots displaying statistical significance versus fold enrichment

Prioritization of Candidates:

• Rank proteins by enrichment factor and statistical significance

• Consider cellular localization (membrane proteins may be more relevant)

• Evaluate conservation across S. aureus strains

• Assess previous evidence from literature or databases

• Prioritize proteins with known roles in stress response or virulence

Validation Strategies:

• Perform reciprocal pull-downs with identified partners

• Use bacterial two-hybrid or split protein complementation assays

• Conduct co-localization studies using fluorescent microscopy

• Evaluate phenotypic effects of partner gene knockouts

• Assess biochemical activity in reconstituted systems

By implementing this comprehensive approach, researchers can distinguish true interacting partners from background contaminants and generate testable hypotheses about SAUSA300_1533 function within cellular networks.

What challenges might researchers encounter when expressing SAUSA300_1533 and how can they be addressed?

Researchers working with SAUSA300_1533 may encounter several challenges during expression and purification, given its predicted membrane-associated nature. These challenges and their potential solutions include:

Successful expression strategies documented for similar membrane proteins include fusion to MBP or GST tags to enhance solubility , expression in specialized E. coli strains like C41/C43 designed for membrane proteins, and careful optimization of induction conditions (temperature, IPTG concentration, duration) . Additionally, researchers should consider protein reprocessing techniques such as renaturation, endotoxin removal, and filtration sterilization as needed for downstream applications .

How can researchers interpret conflicting data regarding SAUSA300_1533 function in different experimental models?

When encountering conflicting data regarding SAUSA300_1533 function across different experimental models, researchers should implement a systematic approach to reconciliation:

Sources of Experimental Variation:

• Different S. aureus genetic backgrounds (USA300 vs. other strains)

• Variations in expression levels of SAUSA300_1533

• Different fusion tags affecting protein function

• Variations in experimental conditions (media, temperature, pH)

• Differences between in vitro and in vivo models

Reconciliation Strategy:

• Standardize Experimental Conditions:

  • Use identical expression constructs across experiments

  • Maintain consistent bacterial growth conditions

  • Quantify SAUSA300_1533 expression levels in each system

• Assess Model-Specific Effects:

  • Determine if conflicts correlate with specific experimental systems

  • Consider host factors present in some models but not others

  • Evaluate environmental stressors unique to each model

• Conduct Bridging Experiments:

  • Design experiments that transition between conflicting models

  • Test intermediate conditions to identify specific variables causing discrepancies

  • Implement dose-response studies to identify threshold effects

• Apply Complementary Approaches:

  • Use cell-selective BONCAT to track protein synthesis in different contexts

  • Combine genetic approaches with biochemical validation

  • Implement systems biology approaches to contextualize conflicting data

• Validate with Clinical Isolates:

  • Test hypotheses in diverse clinical S. aureus isolates

  • Correlate SAUSA300_1533 sequence variations with functional differences

  • Assess expression patterns during human infection

By implementing this methodical approach, researchers can resolve apparent contradictions and develop a more nuanced understanding of SAUSA300_1533 function that accounts for context-dependent effects. This integrated perspective may reveal that seemingly conflicting data actually reflects biological plasticity in protein function across different environments.

How might SAUSA300_1533 research contribute to anti-staphylococcal therapeutic development?

Research on SAUSA300_1533 could significantly contribute to novel anti-staphylococcal therapeutic strategies through multiple avenues. If found to be essential for S. aureus virulence or survival during infection, SAUSA300_1533 could represent a novel drug target. Its membrane localization makes it potentially accessible to antibody-based therapies or small molecule inhibitors that don't require cellular penetration .

Cell-selective proteomic approaches have previously identified novel S. aureus factors important during infection that weren't previously associated with pathogenesis . As an uncharacterized protein (UPF0365 family), SAUSA300_1533 represents the type of overlooked target that might be revealed through unbiased approaches. If structural studies reveal unique folds or active sites, structure-based drug design could be employed to develop specific inhibitors.

Additionally, understanding SAUSA300_1533's role during infection might reveal new aspects of S. aureus pathogenesis. If the protein functions in stress response, metabolic adaptation, or host interaction, this knowledge could inform broader therapeutic strategies beyond direct targeting. Combination therapies incorporating SAUSA300_1533 inhibitors with conventional antibiotics might enhance efficacy or reduce resistance development, particularly if the protein functions in adaptive responses to antimicrobial pressure.

What techniques can be used to determine the three-dimensional structure of SAUSA300_1533?

Determining the three-dimensional structure of SAUSA300_1533 requires selecting appropriate techniques based on the protein's characteristics as a potential membrane protein. Several complementary approaches can be employed:

X-ray Crystallography:

• Requires purification of stable, homogeneous protein

• May need to remove flexible regions and optimize constructs

• For membrane proteins, crystallization in lipidic cubic phases or with detergent micelles

• Molecular replacement using related structures might facilitate solution

Nuclear Magnetic Resonance (NMR) Spectroscopy:

• Suitable for determining dynamic regions and ligand interactions

• Requires isotopic labeling (13C, 15N) during recombinant expression

• Size limitations make this challenging for full-length membrane proteins

• Solution NMR or solid-state NMR for membrane-embedded portions

Cryo-Electron Microscopy (Cryo-EM):

• Increasingly powerful for membrane protein structure determination

• May require incorporation into nanodiscs or amphipols

• Single-particle analysis or tomography depending on size

• Potentially visualize SAUSA300_1533 in native membrane context

Integrative Structural Biology Approaches:

• Combine computational predictions with experimental constraints

• Use crosslinking mass spectrometry to define domain interactions

• Employ hydrogen-deuterium exchange to map exposed regions

• Validate models with site-directed mutagenesis and functional assays

The optimal strategy likely involves expressing different constructs of SAUSA300_1533, including truncated versions that remove predicted flexible regions while maintaining core structural elements. Fusion partners that enhance expression and solubility while facilitating crystallization (T4 lysozyme, BRIL) may be particularly useful for structural studies of this membrane protein .