Recombinant Staphylococcus aureus UPF0365 protein SAV1573 (SAV1573)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; SAV1573; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Target Names
SAV1573
Target Protein Sequence
MFSLSFIVIAVIIIVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH
Uniprot No.

Target Background

Function
Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a significant role in maintaining membrane fluidity.
Database Links

KEGG: sav:SAV1573

STRING: 158878.SAV1573

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What is the SAV1573 protein and what is its role in Staphylococcus aureus?

SAV1573 is a UPF0365 family protein found in Staphylococcus aureus. The UPF0365 protein family comprises uncharacterized proteins with conserved domains. In S. aureus strain Mu50/ATCC 700699, SAV1573 is encoded by the SAV1573 gene locus. While the precise cellular function remains under investigation, structural analysis suggests it may be involved in cellular processes related to the bacterial cell membrane, as indicated by its amino acid sequence containing transmembrane domains . Unlike well-characterized virulence factors such as FnBP and ClfA, SAV1573's specific biological role requires further elucidation through targeted functional studies.

What are the optimal storage conditions for the recombinant SAV1573 protein?

For optimal stability and preservation of biological activity, the recombinant SAV1573 protein should be stored following these guidelines:

  • Long-term storage: -20°C or -80°C in single-use aliquots to prevent degradation from repeated freeze-thaw cycles

  • Working aliquots: Can be maintained at 4°C for up to one week

  • Formulation: Typically supplied in a buffer containing glycerol, which helps maintain protein stability

  • Avoid repeated freeze-thaw cycles: This significantly reduces protein activity and integrity

For research requiring long-term experiments, it is advisable to prepare multiple single-use aliquots upon receipt of the protein to minimize freeze-thaw degradation and ensure experimental reproducibility.

How does the expression system affect the structure and function of recombinant SAV1573?

The expression system significantly impacts the quality and properties of recombinant SAV1573:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, cost-effective, rapid productionPotential improper folding of membrane proteins, limited post-translational modificationsStructural studies, antibody production, functional domain analysis
YeastBetter folding of eukaryotic-like proteins, some post-translational modificationsLower yield than E. coli, longer production timeStudies requiring properly folded protein
BaculovirusExcellent for complex proteins, extensive post-translational modificationsTechnical complexity, higher cost, longer production timeAdvanced structural and functional studies
Mammalian cellsMost authentic modifications, highest likelihood of native conformationHighest cost, longest production time, lowest yieldStudies requiring precise protein-protein interactions

How can recombinant SAV1573 be used in vaccine development research?

While SAV1573 itself has not been extensively studied as a vaccine target, research methodologies from related S. aureus proteins provide a framework for investigation:

  • Epitope Analysis Approach: Using bioinformatics tools such as the Kolaskar and Tongaonkar methods to predict and analyze B cell epitopes within the SAV1573 sequence, similar to approaches used for other S. aureus proteins like FnBP and ClfA .

  • Fusion Protein Strategy: Creating chimeric proteins combining SAV1573 with known immunogenic proteins to potentially enhance immune response, following the methodology used for FC, GS, and FCGS fusion proteins .

  • Challenge Protection Testing: After immunization with recombinant SAV1573 or fusion proteins containing SAV1573 fragments, conducting bacterial challenge tests to evaluate protective efficacy:

    • Measuring antibody production post-immunization

    • Determining bacterial loads in target tissues

    • Assessing survival rates following bacterial challenge

  • Comparative Immunogenicity Analysis: Testing the immunogenic potential of SAV1573 against established virulence factors (FnBP, ClfA) to determine its value in multivalent vaccine formulations .

The selection of antigenic fragments based on epitope prediction is crucial for developing effective vaccines, as demonstrated in studies with other S. aureus proteins .

What methodological approaches are most effective for studying SAV1573 membrane interactions?

Given the predicted transmembrane domains in SAV1573, several specialized techniques can be employed:

  • Liposome Reconstitution Assays: Incorporating purified SAV1573 into artificial membrane systems to study its orientation, topology, and potential transport functions.

  • Fluorescence Resonance Energy Transfer (FRET): Using labeled SAV1573 and membrane components to measure interactions and conformational changes in real-time.

  • Cryo-Electron Microscopy: For visualization of SAV1573 in membrane environments, providing structural insights at near-atomic resolution.

  • Surface Plasmon Resonance (SPR): Quantifying binding kinetics between SAV1573 and potential interaction partners in membrane contexts.

  • Molecular Dynamics Simulations: Complementing experimental approaches with computational modeling of SAV1573 membrane interactions based on the known amino acid sequence .

For membrane protein studies, it's critical to maintain the protein in a membrane-mimetic environment throughout purification and analysis to preserve native conformation and function. Detergent selection is particularly important, with mild non-ionic detergents typically being most suitable for maintaining SAV1573 stability while extracting it from expression system membranes.

How can researchers optimize the expression and purification of SAV1573 for structural studies?

Optimizing SAV1573 expression and purification for structural studies involves several critical considerations:

  • Expression Optimization:

    • Codon optimization based on the expression host

    • Testing multiple fusion tags (His, GST, MBP) for improved solubility

    • Expression temperature adjustment (typically lower temperatures of 16-25°C promote proper folding)

    • Inducer concentration optimization to balance yield and proper folding

  • Purification Strategy:

    • Two-step purification approach: affinity chromatography followed by size exclusion

    • For membrane-associated proteins like SAV1573, include appropriate detergents in all buffers

    • Consider on-column refolding for proteins expressed in inclusion bodies

    • Monitor protein quality by SDS-PAGE and dynamic light scattering between steps

  • Quality Assessment:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Thermal shift assays to identify stabilizing buffer conditions

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monodispersity

    • Limited proteolysis to identify stable domains for crystallization

For crystallization attempts, screening multiple constructs with varying N- and C-terminal boundaries may identify more crystallizable fragments, as the full 329-amino acid protein may be challenging to crystallize, especially with its predicted membrane-associated regions .

How does SAV1573 compare to other UPF0365 family proteins in different Staphylococcus species?

Comparative analysis of UPF0365 family proteins across Staphylococcus species reveals important evolutionary and functional insights:

Staphylococcus SpeciesUPF0365 ProteinSequence Identity to SAV1573Key DifferencesPotential Functional Implications
S. aureus (Mu50)SAV1573100% (reference)-Established in virulent MRSA strain
S. aureus (USA300)USA300HOU_1574>99%Minor substitutions in non-conserved regionsMaintained function in community-acquired MRSA
S. epidermidisSERP1846 (predicted)~70-80%Variations in transmembrane regionsAdapted for commensal lifestyle
S. haemolyticusSH2424 (predicted)~65-75%Differences in C-terminal domainMay reflect host adaptation
S. lugdunensisSLGD_01979 (predicted)~60-70%Significant variations in binding motifsSpecies-specific interactions

The high conservation of this protein across pathogenic Staphylococcus strains suggests important functional roles that have been maintained during evolution. Variations in specific domains may reflect adaptations to different host environments or pathogenicity mechanisms . Comparative structural analysis of these homologs could provide insights into functionally important regions and guide the development of specific inhibitors or antibodies.

What are the critical controls needed when designing immunological experiments with SAV1573?

Designing robust immunological experiments with SAV1573 requires comprehensive controls:

  • Antigen-Specific Controls:

    • Purification tag-only protein to distinguish tag-directed from SAV1573-specific responses

    • Heat-denatured SAV1573 to assess conformational epitope importance

    • Related UPF0365 family proteins from different species to evaluate cross-reactivity

  • Experimental Controls:

    • Positive controls: Known immunogenic S. aureus proteins (e.g., FnBP, ClfA) for comparison

    • Negative controls: Unrelated bacterial proteins of similar size and preparation method

    • Vehicle controls: Buffer-only treatments matching protein formulation

  • Animal Model Controls:

    • Age, gender, and strain-matched animals

    • Pre-immune serum collection for baseline comparison

    • Sham-immunized controls receiving adjuvant only

    • Known immunogen control groups for immunization protocol validation

  • Analytical Controls:

    • Antibody specificity validation using competitive binding assays

    • Isotype controls for flow cytometry and immunohistochemistry

    • Standard curves for quantitative assays (ELISA, cytokine measurements)

    • Testing for cross-reactivity with host proteins

These controls help distinguish SAV1573-specific effects from non-specific or technical artifacts, particularly important when working with a protein whose immunological properties are not yet well-characterized .

How can researchers accurately assess antibody responses to SAV1573 in vaccination studies?

Comprehensive assessment of anti-SAV1573 antibody responses requires multiple complementary approaches:

  • Quantitative Measurements:

    • ELISA for total IgG, IgM, and IgA titers against SAV1573

    • Avidity assays using chaotropic agents to assess antibody maturation

    • Epitope-specific ELISAs using peptide fragments of SAV1573

    • Multiplexed bead-based assays for high-throughput analysis

  • Functional Assessments:

    • Opsonophagocytic killing assays to measure antibody-mediated bacterial clearance

    • Neutralization assays if specific SAV1573 functions are identified

    • Complement deposition assays to assess complement-fixing activity

    • Fc-mediated effector function analysis (ADCC, ADCP)

  • Cellular Response Integration:

    • ELISpot assays to enumerate SAV1573-specific antibody-secreting cells

    • B cell phenotyping to characterize memory B cell generation

    • T-B cell cooperation analysis through cytokine profiling

  • Longevity Assessment:

    • Long-term sampling to track antibody persistence

    • Bone marrow examination for long-lived plasma cells

    • Memory B cell stimulation assays to assess recall potential

This comprehensive approach provides insights beyond simple antibody titers, revealing functional quality and protective potential of the antibody response, essential for vaccine development research .

What bioinformatic approaches should be used to identify potential functional domains in SAV1573?

A systematic bioinformatic workflow for SAV1573 functional domain prediction should include:

  • Sequence-Based Analysis:

    • Protein family classification using Pfam, InterPro, and CDD databases

    • Transmembrane domain prediction using TMHMM, Phobius, and MemBrain

    • Signal peptide identification with SignalP 5.0

    • Conserved motif detection through MEME and GLAM2

    • Disorder prediction via PONDR and IUPred

  • Structure-Based Prediction:

    • Tertiary structure modeling using Phyre2 , I-TASSER, or AlphaFold2

    • Binding site prediction through CASTp, SiteMap, or FTSite

    • Electrostatic surface analysis for potential interaction interfaces

    • Molecular dynamics simulations to identify stable structural elements

  • Comparative Genomics Approaches:

    • Ortholog identification across bacterial species

    • Phylogenetic analysis to trace evolutionary conservation

    • Synteny analysis to identify functionally linked genes

    • Co-evolution analysis to identify interacting partners

  • Integration with Experimental Data:

    • Mapping available proteomic data onto the sequence

    • Incorporation of documented protein-protein interactions

    • Analysis of transcriptomic data to identify co-expressed genes

This multi-layered approach compensates for the limitations of individual prediction methods and provides higher confidence functional annotations for SAV1573 domains, guiding targeted experimental validation .

What are the most effective methods for studying potential interactions between SAV1573 and host proteins?

Investigating SAV1573-host protein interactions requires a multi-technique approach:

  • Initial Screening Methods:

    • Yeast two-hybrid screening against human cDNA libraries

    • Pull-down assays with tagged SAV1573 using different cell lysates

    • Protein arrays to identify binding partners from thousands of host proteins

    • Proximity labeling techniques (BioID, APEX) in cellular contexts

  • Validation and Characterization:

    • Co-immunoprecipitation to confirm interactions in physiological conditions

    • Microscale thermophoresis for quantitative binding parameters

    • Surface plasmon resonance for kinetic binding constants

    • FRET or BRET assays for real-time interaction monitoring

  • Structural Characterization:

    • X-ray crystallography of complexes for atomic-level interaction details

    • Cryo-EM for larger complexes or membrane-associated interactions

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Cross-linking mass spectrometry to identify proximity relationships

  • Functional Validation:

    • Mutational analysis of predicted interaction interfaces

    • Competition assays with peptide fragments

    • Cell-based functional assays with knockdown/knockout of interaction partners

    • In vivo validation in animal models with modified SAV1573 variants

This comprehensive approach not only identifies potential host targets but also characterizes the nature and biological significance of these interactions, providing insights into potential virulence mechanisms or therapeutic targets .

How should researchers interpret apparent contradictions in SAV1573 experimental results across different studies?

When confronting contradictory results regarding SAV1573 across studies, researchers should systematically evaluate:

Contradictory results should be viewed as opportunities to discover context-dependent functions or regulatory mechanisms rather than simply experimental errors. This approach can lead to deeper understanding of SAV1573's complex biological roles .

What statistical approaches are most appropriate for analyzing SAV1573 immunization data?

Analyzing SAV1573 immunization data requires tailored statistical approaches based on experimental design and outcome measures:

  • Antibody Response Analysis:

    • Mixed-effects models for longitudinal antibody titer data

    • Area-under-curve (AUC) analysis for kinetic antibody responses

    • Non-parametric methods (Mann-Whitney U, Kruskal-Wallis) for titer comparisons when distributions are non-normal

    • Correlation analysis between different antibody isotypes or epitope-specific responses

  • Challenge Protection Studies:

    • Kaplan-Meier survival analysis with log-rank tests for mortality data

    • Repeated measures ANOVA for body weight or clinical scores over time

    • Negative binomial regression for bacterial load count data which is typically over-dispersed

    • Fisher's exact test for categorical protection outcomes

  • Multivariate Approaches:

    • Principal component analysis to identify patterns across multiple immune parameters

    • Hierarchical clustering to identify responder subgroups

    • Discriminant analysis to determine predictors of protection

    • Path analysis to model relationships between immunological parameters and protection

  • Power and Sample Size Considerations:

    • A priori power calculations based on expected effect sizes from pilot data

    • Sequential analysis methods for ethical reduction of animal numbers

    • Bayesian approaches for incorporating prior knowledge from related proteins

How can researchers effectively compare the immunogenic potential of SAV1573 with other S. aureus proteins?

Systematic comparison of SAV1573's immunogenic potential with other S. aureus proteins requires a multidimensional approach:

  • Standardized Comparative Platform:

    • Parallel immunization protocols with identical adjuvants, dosing, and schedules

    • Consistent protein preparation methods to minimize technical variables

    • Side-by-side testing in the same animal cohorts when possible

    • Inclusion of established benchmark antigens (e.g., FnBP, ClfA) as reference standards

  • Comprehensive Immune Response Profiling:

    • Quantitative comparison of antibody titers, avidity, and isotype distribution

    • Epitope mapping to compare breadth of antibody responses

    • T-cell response characterization (proliferation, cytokine profiles)

    • Functional antibody assays (opsonophagocytic, neutralization)

  • Protection Metrics:

    • Standardized challenge models with consistent bacterial strains and doses

    • Multiple protection endpoints (survival, bacterial burden, pathology scores)

    • Passive immunization studies to directly compare antibody-mediated protection

    • Combination studies to assess additive or synergistic effects

  • Comparative Data Visualization and Analysis:

    • Radar plots for multidimensional immune response comparison

    • Heat maps for epitope recognition patterns across antigens

    • Principal component analysis to identify distinguishing immunological features

    • Formal meta-analysis when multiple independent studies are available

This structured approach allows objective ranking of SAV1573's immunogenic properties relative to other S. aureus antigens, informing rational vaccine antigen selection and combination strategies .

What are the most promising research directions for understanding SAV1573's role in S. aureus pathogenesis?

Several high-priority research directions could elucidate SAV1573's role in pathogenesis:

  • Genetic Manipulation Studies:

    • Generation of SAV1573 knockout and complemented strains in diverse S. aureus backgrounds

    • Conditional expression systems to study essentiality under different conditions

    • Site-directed mutagenesis of conserved residues to identify functional domains

    • CRISPR interference for temporal control of expression during infection

  • Infection Model Evaluation:

    • Comparative virulence studies between wild-type and SAV1573-modified strains

    • Tissue-specific colonization and dissemination analysis

    • Host response characterization during infection with SAV1573 variants

    • Competitive infection assays to measure fitness contributions

  • Protein Interaction Networks:

    • Bacterial interactome analysis to identify functional protein complexes

    • Host-pathogen interaction screening to identify target host proteins

    • Membrane protein complex analysis using native PAGE approaches

    • Temporal interaction dynamics during different infection stages

  • Structural Biology Approaches:

    • High-resolution structure determination of SAV1573

    • Structural comparison with homologs from other pathogens

    • Structure-function correlation through guided mutagenesis

    • Molecular dynamics simulations in membrane environments

These approaches would collectively build a comprehensive understanding of SAV1573's contribution to S. aureus virulence mechanisms, potentially revealing new therapeutic targets or vaccine candidates .

How might high-throughput screening approaches be applied to identify inhibitors of SAV1573 function?

Developing a high-throughput screening (HTS) pipeline for SAV1573 inhibitors requires:

  • Assay Development:

    • Function-based assays if specific enzymatic or binding activities are identified

    • Thermal shift assays to identify compounds stabilizing protein conformation

    • Surface plasmon resonance-based fragment screening

    • Cellular reporter systems if phenotypic changes can be linked to SAV1573 function

  • Compound Library Selection:

    • Focused libraries targeting membrane proteins

    • Natural product collections with antimicrobial track records

    • Peptidomimetic libraries targeting protein-protein interactions

    • Fragment libraries for structure-based drug design approaches

  • Screening Cascade Design:

    • Primary screening at single concentration (10-20 μM typical)

    • Dose-response confirmation of primary hits

    • Counter-screening against related proteins to assess selectivity

    • Cytotoxicity assessment against mammalian cell lines

    • Antibacterial activity testing against S. aureus and other pathogens

  • Hit-to-Lead Optimization:

    • Structure-activity relationship studies around confirmed hits

    • In silico docking and molecular dynamics to guide optimization

    • Medicinal chemistry refinement for pharmacokinetic properties

    • Resistance development assessment to evaluate barrier to resistance

This systematic approach could identify novel antimicrobial agents targeting SAV1573, potentially addressing the growing challenge of antibiotic resistance in S. aureus infections .

What are the key challenges and strategies for developing a multivalent vaccine incorporating SAV1573?

Development of a multivalent vaccine incorporating SAV1573 faces several challenges requiring specific strategies:

  • Antigen Selection and Optimization:

    • Challenge: Identifying optimal SAV1573 epitopes with protective potential

    • Strategy: Systematic epitope mapping combined with immunization studies testing different protein fragments, similar to approaches used for FnBP and ClfA

  • Antigen Combination Effects:

    • Challenge: Potential antigenic competition or interference between components

    • Strategy: Rational design of fusion proteins with optimized linkers to preserve epitope structure and accessibility, as demonstrated with the FCGS approach

  • Formulation and Stability:

    • Challenge: Maintaining structural integrity of multiple antigens in a single formulation

    • Strategy: Comprehensive stability studies with varying adjuvants, pH conditions, and temperatures to identify optimal formulation parameters

  • Immune Response Balancing:

    • Challenge: Ensuring balanced immune responses to all vaccine components

    • Strategy: Adjuvant selection and dosing optimization to promote appropriate Th1/Th2/Th17 balance for optimal protection

  • Efficacy Evaluation:

    • Challenge: Developing appropriate challenge models that reflect clinical disease

    • Strategy: Multiple animal models including mouse systemic infection and specialized models for specific disease manifestations (e.g., mastitis models for bovine applications)

  • Cross-Protection Assessment:

    • Challenge: Ensuring coverage against diverse S. aureus strains

    • Strategy: Challenge studies with genetically diverse clinical isolates and analysis of epitope conservation across strain collections

The successful development of such a vaccine requires iterative optimization through preclinical studies before advancing to clinical evaluation, with careful attention to both immunological and manufacturing considerations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.