Recombinant Staphylococcus aureus UPF0365 protein USA300HOU_1574 (USA300HOU_1574)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your request.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
floA; USA300HOU_1574; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Staphylococcus aureus (strain USA300 / TCH1516)
Target Names
USA300HOU_1574
Target Protein Sequence
MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are considered crucial regulators of membrane fluidity.

Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

How does the amino acid sequence of USA300HOU_1574 compare across different S. aureus strains?

Comparative analysis reveals high conservation of this protein across different S. aureus strains. For example, the UPF0365 protein SaurJH1_1665 from the JH1 strain exhibits identical amino acid sequence to USA300HOU_1574, suggesting functional conservation across strains . This high level of conservation may indicate an essential role in bacterial physiology rather than strain-specific adaptations.

Researchers should note that despite sequence conservation, strain-specific variations in expression levels or post-translational modifications may exist. When designing comparative studies across strains, these factors should be considered in the experimental design and data interpretation .

What are the optimal expression systems for recombinant USA300HOU_1574 production?

Multiple expression systems can be utilized for USA300HOU_1574 recombinant production, with E. coli being the most commonly reported successful system. Based on the available data, the following table compares expression systems:

Expression SystemAdvantagesDisadvantagesReported YieldRecommended Application
E. coliHigh yield, cost-effective, rapid expressionPotential improper folding for membrane proteinsHigh (>90% purity)Structural studies, antibody production
YeastBetter folding for eukaryotic targetsSlower, more complex mediaModerateFunctional studies
Mammalian cellsNative-like post-translational modificationsExpensive, time-consumingLow-moderateInteraction studies
Insect cellsGood for toxic proteinsComplex setupModerateSpecialized applications

For USA300HOU_1574, E. coli expression systems have demonstrated successful production of recombinant protein with high purity levels (>90% as determined by SDS-PAGE) . The protein has been successfully expressed as a full-length protein (1-329 amino acids) with an N-terminal His-tag .

What are the methodological considerations for designing experiments to study USA300HOU_1574 in the context of biofilm formation?

When designing experiments to study USA300HOU_1574 in biofilm formation, several methodological considerations should be addressed:

  • Experimental Setup: Based on biofilm research protocols, use confocal laser scanning microscopy (CLSM) time-lapse imaging to visualize the role of USA300HOU_1574 in early biofilm formation. This approach has been validated in S. aureus biofilm studies .

  • Statistical Power and Sampling Strategy: To ensure statistical validity, design experiments with:

    • Multiple independent experiments (recommended n ≥ 6)

    • Multiple fields of view (FOV) per experiment (recommended n ≥ 12)

    • Appropriate temporal resolution (e.g., 2-3 minute intervals over 4-hour time courses)

  • Controls and Variables:

    • Include both wild-type and USA300HOU_1574 knockout/modified strains

    • Consider different growth phases (lag phase vs. exponential phase) as variability differs substantially between these phases

    • Account for potential extraneous variables such as media composition and culture conditions

  • Quantification Methods:

    • Use established metrics like GFP-tagged bacteria for biomass quantification

    • Apply thresholding techniques to quantify bacterial green fluorescence in collected images

    • Calculate log reductions (LR) to measure treatment efficacy

When examining protein function in biofilms, researchers should recognize that initial seeding conditions may affect variability and must be assessed for each experimental system. Variability typically changes as a frown-shaped function of treatment efficacy .

How can researchers effectively study the interaction between USA300HOU_1574 and the human immune system?

To study interactions between USA300HOU_1574 and human immune system components, researchers should consider the following methodological approach:

  • Preparation of Recombinant Protein:

    • Express USA300HOU_1574 with appropriate tags (His-tag recommended) for purification and detection

    • Ensure protein purity >90% as determined by SDS-PAGE

    • Consider using E. coli expression systems with optimized codon usage for higher yields

  • Neutrophil Interaction Studies:

    • Based on established S. aureus-neutrophil interaction protocols, culture human neutrophils (PMNs) in appropriate media

    • Establish a controlled environment system maintaining 5% CO₂, 20% O₂, 50% humidity, and 37°C

    • Use fluorescently labeled components (e.g., GFP-tagged bacteria and differentially labeled PMNs)

    • Employ CLSM with sequential imaging at short intervals (2-3 minutes) over 4-hour timeframes

  • Quantitative Analysis:

    • Measure changes in bacteria biomass using image analysis software (e.g., MetaMorph)

    • Calculate log reductions in fluorescence area for treated versus untreated samples

    • Use statistical approaches that account for the multi-level nature of the experimental design

  • Experimental Design Considerations:

    • Include multiple independent experiments (n ≥ 10 recommended)

    • Use multiple fields of view per condition

    • Consider different PMN concentrations to establish dose-dependent effects

    • Include appropriate controls (bacteria-only wells)

This approach provides a robust framework for investigating how USA300HOU_1574 interacts with human immune cells, potentially revealing its role in S. aureus immune evasion mechanisms.

What are the advanced techniques for studying the structural properties of USA300HOU_1574?

Advanced structural studies of USA300HOU_1574 require specialized techniques and careful experimental design:

  • Protein Preparation for Structural Analysis:

    • Express with minimal tags or use tag-free systems to avoid interference with structure

    • Consider deglycosylation under native conditions if glycosylation is present

    • Optimize buffer conditions for structural stability

  • Crystallization and X-ray Crystallography:

    • Screen multiple crystallization conditions using commercially available kits

    • For membrane-associated proteins like USA300HOU_1574, consider detergent screening

    • Process diffraction data using standard crystallographic software packages

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • For a 329-amino acid protein like USA300HOU_1574, consider segmental labeling approaches

    • Use isotopic labeling (¹⁵N, ¹³C) for detailed structural analysis

    • Analyze chemical shifts to determine secondary structure elements

  • Cryo-Electron Microscopy:

    • Particularly useful if USA300HOU_1574 forms larger complexes

    • Optimize sample vitrification conditions

    • Process data using single-particle analysis techniques

  • Computational Structure Prediction:

    • Employ homology modeling based on related UPF0365 family proteins

    • Validate predictions with limited experimental data (e.g., circular dichroism)

    • Use molecular dynamics simulations to explore conformational flexibility

When designing structural biology experiments, researchers should account for the membrane-associated nature of this protein, which may require specialized approaches for optimal results.

How should researchers approach contradictory findings in USA300HOU_1574 functional studies?

When encountering contradictory findings in USA300HOU_1574 research, a systematic approach to data analysis and contradiction resolution should be employed:

By applying these methodological approaches, researchers can systematically evaluate contradictory findings and develop a more coherent understanding of USA300HOU_1574 function.

What statistical considerations should be incorporated when designing experiments to study the effect of USA300HOU_1574 knockouts on bacterial fitness?

When designing knockout studies to assess USA300HOU_1574's impact on bacterial fitness, several statistical considerations are crucial:

  • Sample Size Determination:

    • Conduct power analysis based on pilot data to determine appropriate sample sizes

    • For confocal microscopy studies, aim for at least 6 independent experiments with 12 fields of view per condition

    • Larger effect sizes require fewer replicates, but smaller or subtle effects necessitate increased replication

  • Experimental Design Structure:

    • Consider nested designs to account for within-experiment correlation

    • Balance the number of fields of view per experiment against the number of independent experiments

    • Implement appropriate randomization at multiple levels of the experimental hierarchy

  • Growth Phase Considerations:

    • Account for differential variability between growth phases (lag vs. exponential)

    • Design experiments to capture both phases if relevant to the research question

    • Adjust statistical models to accommodate phase-specific variance patterns

  • Statistical Analysis Approaches:

    • Use mixed-effects models to account for the hierarchical nature of the data

    • Consider non-parametric approaches if data violate normality assumptions

    • Implement appropriate multiple comparison corrections when testing multiple hypotheses

    • For time-series data, apply longitudinal analysis methods

  • Variability Assessment Tools:

    • Utilize spreadsheet-based experimental design assessment tools (available in supplementary materials of reference studies)

    • Input expected mean log reduction and variance components from pilot experimental results

    • Assess various experimental designs before committing to full-scale studies

By incorporating these statistical considerations into experimental design, researchers can increase the reliability and reproducibility of findings regarding USA300HOU_1574's role in bacterial fitness.

What methodological approaches can be used to determine the biological function of USA300HOU_1574?

Determining the biological function of USA300HOU_1574 requires a multi-faceted approach:

  • Comparative Genomics:

    • Analyze sequence conservation across different S. aureus strains

    • Identify orthologs in related bacterial species

    • Examine genomic context for insights into functional associations

  • Protein-Protein Interaction Studies:

    • Implement pull-down assays using His-tagged USA300HOU_1574

    • Perform yeast two-hybrid screening to identify interaction partners

    • Validate interactions using complementary methods such as co-immunoprecipitation

    • Map the interactome to identify functional networks

  • Gene Expression Analysis:

    • Use RNA-seq to identify genes co-regulated with USA300HOU_1574

    • Perform qRT-PCR to validate expression patterns under different conditions

    • Analyze promoter regions for regulatory elements

  • Loss-of-Function Studies:

    • Generate knockout mutants using CRISPR-Cas9 or conventional methods

    • Perform phenotypic characterization of mutants under various conditions

    • Conduct complementation studies to confirm phenotype specificity

  • Structural Function Analysis:

    • Identify conserved domains and motifs

    • Perform site-directed mutagenesis of key residues

    • Correlate structural features with functional outcomes

This integrated approach allows researchers to build a comprehensive understanding of USA300HOU_1574's biological role within S. aureus cells.

How can researchers efficiently design experiments to identify pathways involving USA300HOU_1574?

To efficiently identify pathways involving USA300HOU_1574, researchers should implement the following experimental design strategy:

  • Preliminary Pathway Analysis:

    • Examine existing pathway databases for UPF0365 family proteins

    • Create a hypothesis-based initial pathway model

    • Identify key hub proteins for targeted validation

  • Experimental Validation Approach:

    • Prioritize experiments based on their information yield

    • Design factorial experiments to test multiple pathway components simultaneously

    • Implement a sequential experimental strategy, with each experiment informed by previous results

  • Integrated Multi-omics Approach:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Correlate USA300HOU_1574 expression with global cellular changes

    • Apply pathway enrichment analysis to identify significantly affected pathways

  • Perturbation Experiments:

    • Design targeted interventions (e.g., inhibitors, environmental stressors)

    • Measure system-wide responses using high-throughput methods

    • Model the network to predict pathway interactions

  • Validation in Infection Models:

    • Test pathway hypotheses in relevant infection models

    • Use conditional expression systems to manipulate USA300HOU_1574 levels

    • Correlate pathway activity with virulence phenotypes

By implementing this structured approach to pathway identification, researchers can efficiently characterize the biological context of USA300HOU_1574 function while minimizing experimental redundancy and maximizing information gain.

What strategies can be employed to optimize the expression and stability of recombinant USA300HOU_1574?

Optimizing recombinant USA300HOU_1574 expression and stability requires several targeted strategies:

  • Codon Optimization:

    • Analyze the accessibility of translation initiation sites using mRNA base-unpairing across Boltzmann's ensemble

    • Apply synonymous substitutions in the first nine codons to enhance expression

    • Consider the target expression system when designing optimization strategies

    • Tools like TIsigner can be utilized to predict optimal codon usage

  • Expression Vector Design:

    • Select appropriate promoters based on expression goals (constitutive vs. inducible)

    • Choose optimal fusion tags (His-tag has proven effective for USA300HOU_1574)

    • Consider tag position (N-terminal vs. C-terminal) based on protein structure

    • Incorporate appropriate purification and detection elements

  • Expression Conditions Optimization:

    • Systematically test induction parameters (temperature, inducer concentration, time)

    • Optimize media composition for target expression system

    • Consider specialized conditions for membrane-associated proteins

    • Implement statistical design of experiments (DoE) approach to efficiently identify optimal conditions

  • Stability Enhancement:

    • Formulate with appropriate buffers (Tris-based buffers with 6% Trehalose at pH 8.0 have been effective)

    • Add stability enhancers like glycerol (50% final concentration recommended)

    • Store at -20°C/-80°C for long-term storage, with working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

  • Solubility Improvement:

    • Consider fusion partners known to enhance solubility (MBP, GST, trxA, Nus)

    • Test detergent screens for membrane-associated proteins

    • Implement refolding protocols if expression yields inclusion bodies

These strategies can significantly improve the yield and stability of recombinant USA300HOU_1574, enabling more robust experimental applications.

How can researchers design experiments to study the potential role of USA300HOU_1574 in antibiotic resistance?

To investigate the potential role of USA300HOU_1574 in antibiotic resistance mechanisms, researchers should implement the following experimental design approach:

  • Expression Correlation Analysis:

    • Compare USA300HOU_1574 expression levels between antibiotic-sensitive and resistant S. aureus strains

    • Perform time-course expression analysis during antibiotic challenge

    • Correlate expression with minimum inhibitory concentration (MIC) values across strain panels

  • Genetic Modification Studies:

    • Generate USA300HOU_1574 knockout mutants

    • Create overexpression strains

    • Assess changes in antibiotic susceptibility profiles using standardized methods

    • Test multiple antibiotic classes to identify specific resistance mechanisms

  • Mechanistic Investigation:

    • Examine membrane integrity in modified strains using fluorescent dyes

    • Measure antibiotic uptake and efflux in wild-type vs. modified strains

    • Assess cell wall composition and membrane properties

    • Investigate protein-protein interactions with known resistance determinants

  • Time-Lapse Microscopy Approach:

    • Use the validated CLSM methodology with the following parameters:

      • Multiple independent experiments (n ≥ 6)

      • Multiple fields of view per experiment (n ≥ 12)

      • Imaging at 2-3 minute intervals over 4-hour timeframes

    • Compare wild-type and modified strains during antibiotic challenge

    • Quantify survival and morphological changes

  • Antibiotic Treatment Protocol:

    • Based on established methods, attach S. aureus to surfaces

    • Grow for 3 hours in appropriate media

    • Challenge with antibiotics (e.g., 10 μg/mL gentamicin)

    • Image for 4 hours to track responses

This comprehensive experimental design allows researchers to systematically investigate USA300HOU_1574's potential role in antibiotic resistance, providing robust evidence for its functional significance in this clinically relevant phenotype.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.