Recombinant Staphylococcus aureus UPF0382 membrane protein SAB0533 (SAB0533)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SAB0533; UPF0382 membrane protein SAB0533
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Staphylococcus aureus (strain bovine RF122 / ET3-1)
Target Names
SAB0533
Target Protein Sequence
MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGTITPIGGVLFIIGWIMLIIATFKF AG
Uniprot No.

Target Background

Database Links

KEGG: sab:SAB0533

Protein Families
UPF0382 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is SAB0533 typically expressed and purified for research purposes?

Recombinant SAB0533 is commonly expressed in E. coli expression systems with an affinity tag (often His-tag) to facilitate purification . The general methodology involves:

  • Cloning the SAB0533 gene into an appropriate expression vector

  • Transforming the construct into E. coli

  • Inducing protein expression under optimized conditions

  • Cell lysis and membrane fraction isolation

  • Solubilization of membrane proteins using detergents

  • Affinity chromatography using the His-tag

  • Further purification steps (size exclusion, ion exchange)

For optimal results with this membrane protein, researchers should consider:

  • Using mild detergents for solubilization to maintain native conformation

  • Including glycerol (typically 50%) in buffers to enhance stability

  • Storing at -20°C for short-term use or -80°C for extended storage

  • Avoiding repeated freeze-thaw cycles which can compromise protein integrity

What are the known biological functions of SAB0533 in S. aureus?

The specific biological functions of SAB0533 are not fully characterized in the available literature. As a UPF0382 membrane protein, it likely plays a role in membrane integrity, transport, or signaling pathways in S. aureus.

While direct functional studies on SAB0533 appear limited, its classification as a membrane protein suggests possible roles in:

  • Cell envelope maintenance

  • Nutrient transport

  • Stress response

  • Antimicrobial resistance

Further investigation through knockout studies, protein-protein interaction analyses, and phenotypic assays would be necessary to elucidate its specific functions in S. aureus physiology and pathogenicity.

How does SAB0533 compare structurally and functionally to other S. aureus membrane proteins?

SAB0533 belongs to the broader category of S. aureus membrane proteins, but has distinct structural features compared to well-characterized membrane proteins like PrsA. While PrsA is a membrane-anchored lipoprotein that functions as a foldase to assist in post-translocational folding of secreted proteins , SAB0533 is an integral membrane protein with multiple transmembrane domains.

Comparative analysis between SAB0533 and other S. aureus membrane proteins reveals:

ProteinTypeSize (aa)Known FunctionsCellular Location
SAB0533UPF0382 membrane protein122Not fully characterizedIntegral membrane
PrsAFoldase/chaperone~300Assists protein folding, involved in antibiotic resistanceMembrane-anchored lipoprotein
SpA (Protein A)Surface protein~500Immune evasion, binds Fc region of antibodiesCell wall/secreted

Unlike PrsA, which has been shown to contribute to the folding and secretion of virulence factors such as SpA , the specific role of SAB0533 in pathogenicity mechanisms remains to be fully elucidated.

What experimental approaches are most effective for studying membrane protein-protein interactions involving SAB0533?

Investigating protein-protein interactions involving membrane proteins like SAB0533 presents unique challenges due to their hydrophobic nature. Based on methodologies used for similar proteins, researchers should consider:

  • Crosslinking studies coupled with mass spectrometry:

    • Chemical crosslinkers can capture transient interactions

    • In vivo crosslinking followed by pull-down assays with His-tagged SAB0533

    • Mass spectrometry analysis to identify interaction partners

  • Co-immunoprecipitation with specific considerations for membrane proteins:

    • Optimize detergent conditions to maintain protein structure while solubilizing membranes

    • Use gentle elution conditions to preserve interactions

    • This approach was effective for demonstrating PrsA interactions in S. aureus

  • Bacterial two-hybrid or split-protein complementation assays:

    • Adapted for membrane protein studies

    • Can detect interactions in a more native-like environment

  • Surface plasmon resonance or microscale thermophoresis:

    • For quantitative measurement of binding kinetics

    • Requires careful buffer optimization to maintain protein stability

When studying potential interactions between SAB0533 and other S. aureus proteins, researchers should consider examining proteins that function in similar cellular compartments or processes, particularly those involved in membrane organization or transport.

How might SAB0533 contribute to S. aureus pathogenicity and virulence mechanisms?

While direct evidence linking SAB0533 to S. aureus virulence is lacking in the provided sources, potential contributions can be hypothesized based on what is known about other S. aureus membrane proteins:

  • Possible role in membrane integrity and antibiotic resistance:

    • Membrane proteins like PrsA in S. aureus contribute to glycopeptide and oxacillin resistance

    • SAB0533 could similarly contribute to cell envelope stability under stress conditions

  • Potential involvement in secretion of virulence factors:

    • If SAB0533 functions in membrane organization, it might indirectly affect the secretion of virulence factors

    • For comparison, PrsA deletion significantly decreases the abundance of SpA in both cell wall fractions and culture medium

  • Possible role in host-pathogen interactions:

    • S. aureus employs numerous molecules for immune evasion

    • As a membrane protein, SAB0533 could potentially interact with host factors or affect the presentation of surface virulence factors

To investigate these possibilities, researchers could design knockout studies of SAB0533 and assess impacts on:

  • Antimicrobial susceptibility profiles

  • Virulence factor expression and secretion

  • Survival under host-relevant stress conditions

  • Virulence in infection models

What are the specific challenges and solutions for expressing recombinant SAB0533 protein?

Expressing membrane proteins like SAB0533 presents several unique challenges:

Challenges:

  • Protein hydrophobicity: The highly hydrophobic nature of SAB0533 can lead to aggregation, misfolding, and inclusion body formation in E. coli expression systems .

  • Toxicity to expression host: Overexpression of membrane proteins can disrupt bacterial membrane integrity, affecting cell viability .

  • Codon usage: Rare codons in the SAB0533 sequence might impede efficient translation in heterologous expression systems .

  • Proper folding: Ensuring correct folding and insertion into membranes is critical for functional studies.

Solutions:

  • Expression system optimization:

    • Use specialized E. coli strains designed for membrane protein expression (C41, C43)

    • Consider lower induction temperatures (16-25°C) to slow expression and aid folding

    • Employ tightly controlled induction systems to manage expression levels

  • Solubilization strategies:

    • Screen multiple detergents for optimal solubilization (DDM, LDAO, etc.)

    • Consider using amphipols or nanodiscs for stabilization

    • Include glycerol and appropriate salt concentrations in buffers

  • Fusion tag approaches:

    • N-terminal fusion partners (MBP, GST) can enhance solubility

    • Consider using dual tags for improved purification strategies

  • Codon optimization:

    • Custom synthesis of the SAB0533 gene with codons optimized for the expression host

To validate proper expression and folding, researchers should employ multiple analytical techniques including Western blotting, circular dichroism, and functional assays appropriate to membrane proteins.

How can researchers effectively study the localization and membrane topology of SAB0533?

Understanding the precise localization and topology of SAB0533 within the S. aureus membrane is crucial for functional characterization. Recommended methodologies include:

  • Protease accessibility assays:

    • Incubate intact cells or spheroplasts with proteases

    • Analyze protected fragments to determine membrane-embedded regions

    • Compare with bioinformatic predictions of transmembrane domains

  • Reporter fusion approaches:

    • Generate fusions with reporters like GFP, PhoA, or β-lactamase at various positions

    • Expression patterns reveal orientation relative to the membrane

  • Immunogold electron microscopy:

    • Utilize antibodies against epitope-tagged SAB0533

    • Provides direct visualization of cellular localization

  • Substituted cysteine accessibility method (SCAM):

    • Introduce cysteines at predicted transmembrane boundaries

    • Test accessibility to sulfhydryl-specific reagents

    • Reveals which regions are exposed to aqueous environment

  • Fluorescence resonance energy transfer (FRET):

    • Introduce fluorescent labels at strategic positions

    • Measure distances between domains to determine folding pattern

When designing these experiments, researchers should consider the predicted membrane topology based on hydrophobicity plots of the SAB0533 sequence and compare results across multiple approaches for validation.

What bioinformatic approaches are most valuable for predicting SAB0533 structure and function?

Given the challenges in experimentally determining membrane protein structures, computational approaches provide valuable insights:

  • Transmembrane domain prediction:

    • Tools: TMHMM, Phobius, MEMSAT

    • Predict membrane-spanning regions based on hydrophobicity profiles

    • Critical for designing topology studies and fusion constructs

  • Homology modeling:

    • Search for structural homologs using HHpred, Phyre2

    • Build models based on related UPF0382 family members

    • Validate models through molecular dynamics simulations in membrane environments

  • Functional prediction:

    • Gene neighborhood analysis to identify operons containing SAB0533

    • Identification of conserved domains and motifs

    • Co-expression network analysis across different conditions

  • Evolutionary analysis:

    • Phylogenetic profiling to identify co-evolving proteins

    • Conservation analysis across Staphylococcal species

    • Identification of potential functionally important residues

Researchers should employ these computational approaches in combination, as each provides different insights and may compensate for limitations in individual methods.

How might SAB0533 research contribute to S. aureus vaccine development strategies?

S. aureus vaccine development has historically focused on surface antigens and secreted toxins . While SAB0533 hasn't been specifically mentioned in vaccine development literature, membrane proteins represent potential vaccine targets.

Current S. aureus vaccine approaches primarily utilize:

  • Recombinant protein antigens (surface proteins or toxins)

  • Polysaccharide antigens (capsular polysaccharides)

  • Bioconjugation of polysaccharides to carrier proteins

Potential applications of SAB0533 research to vaccine development:

  • Assessment as a novel vaccine antigen:

    • If SAB0533 is found to be surface-exposed and conserved across S. aureus strains

    • Determine immunogenicity in animal models

    • Evaluate protective efficacy against challenge

  • Structural insights for rational vaccine design:

    • Identification of exposed epitopes within SAB0533

    • Design of constructs that present these epitopes optimally

  • Consideration as a bioconjugate carrier:

    • Recent research suggests that using S. aureus proteins as carriers for capsular polysaccharides improves vaccine immunogenicity compared to using proteins from unrelated bacteria

    • If SAB0533 proves immunogenic, it could be evaluated as a carrier protein

Researchers should note that previous high-profile S. aureus vaccines using conjugated capsular polysaccharides have failed in clinical trials , emphasizing the need for novel approaches potentially including membrane proteins.

What are the most promising approaches for targeting SAB0533 in antimicrobial development?

If SAB0533 is found to be essential for S. aureus survival or virulence, it could represent a novel antimicrobial target. Potential strategies include:

  • Structure-based drug design:

    • Utilize homology models or experimental structures to identify binding pockets

    • Virtual screening for small molecules that bind to functional regions

    • Fragment-based approaches to develop high-affinity ligands

  • Peptide inhibitors:

    • Design peptides that mimic interaction partners of SAB0533

    • Target exposed loops with higher immunogenicity

    • Develop stabilized peptidomimetics for improved pharmacokinetics

  • Antibody-based approaches:

    • If certain domains are accessible from the cell surface

    • Potential for antibody-drug conjugates or immunotherapy

  • Antisense strategies:

    • Targeted inhibition of SAB0533 expression

    • Peptide nucleic acids (PNAs) designed to bind SAB0533 mRNA

When evaluating SAB0533 as an antimicrobial target, researchers should consider:

  • Conservation across clinical S. aureus isolates

  • Presence of homologs in commensal bacteria

  • Accessibility to inhibitors in the context of the bacterial cell envelope

  • Functional importance in clinically relevant conditions

How can interdisciplinary collaboration enhance research on proteins like SAB0533?

Research on complex proteins like SAB0533 benefits significantly from interdisciplinary approaches. Based on qualitative analysis of interdisciplinary interactions , researchers should consider:

  • Effective communication strategies between specialists:

    • Use of definitions in lay language to bridge knowledge gaps

    • Employment of thought experiments to clarify methodological concepts

    • Utilization of metaphors and analogies to translate concepts across fields

    • Anticipation of study outcomes to provide context for current experimental design

  • Collaborative framework for SAB0533 research:

    • Structural biologists for membrane protein analysis

    • Microbiologists for functional characterization in S. aureus

    • Immunologists for vaccine potential assessment

    • Bioinformaticians for computational modeling

    • Medicinal chemists for inhibitor design

  • Interdisciplinary data interpretation:

    • Regular joint analysis meetings with defined terminology

    • Documentation of assumptions from different fields

    • Cross-validation of findings using complementary approaches

  • Technology integration:

    • Combining structural methods (X-ray, cryo-EM, NMR)

    • Integrating functional genomics with phenotypic assays

    • Correlating in vitro findings with in vivo models

Implementing these collaborative approaches can accelerate research progress and lead to more comprehensive understanding of complex membrane proteins like SAB0533.

What novel techniques might advance our understanding of SAB0533 function in S. aureus pathogenesis?

Several cutting-edge approaches could significantly enhance our understanding of SAB0533:

These approaches would complement traditional methodologies and potentially reveal unexpected aspects of SAB0533 function in S. aureus pathogenesis.

How might comparative analysis across S. aureus strains inform our understanding of SAB0533?

Comparative genomics and proteomics across diverse S. aureus strains could provide valuable insights:

  • Sequence conservation analysis:

    • Compare SAB0533 sequences across clinical, commensal, and animal-adapted strains

    • Identify conserved regions that may be functionally essential

    • Detect strain-specific variations that might correlate with virulence

  • Expression pattern comparison:

    • Analyze SAB0533 expression levels in different S. aureus lineages

    • Correlate with strain-specific virulence profiles

    • Determine if expression is altered in antibiotic-resistant strains

  • Genetic context examination:

    • Analyze the genomic neighborhood of SAB0533 across strains

    • Identify co-evolved genes that may function with SAB0533

    • Detect horizontal gene transfer events affecting this locus

  • Structural variation investigation:

    • Identify strain-specific post-translational modifications

    • Compare membrane topology across variants

    • Assess impact on protein-protein interactions

This comparative approach could reveal whether SAB0533 functions are conserved or divergent across the species, informing both fundamental understanding and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.