Recombinant Staphylococcus aureus UPF0382 membrane protein SAOUHSC_00567 (SAOUHSC_00567)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SAOUHSC_00567; UPF0382 membrane protein SAOUHSC_00567
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Staphylococcus aureus (strain NCTC 8325)
Target Names
SAOUHSC_00567
Target Protein Sequence
MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWIMLIIATFKF AG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0382 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional classification of SAOUHSC_00567 in S. aureus?

SAOUHSC_00567 belongs to the UPF0382 family of membrane proteins found in Staphylococcus aureus, with potential connections to the broader Up-frameshift (Upf) protein factors involved in mRNA quality control mechanisms. Based on current research into similar proteins, these factors are known to eliminate aberrant mRNAs containing premature termination codons (PTCs) as demonstrated in various model organisms . The UPF0382 designation indicates it belongs to an uncharacterized protein family (UPF) that likely performs important but not yet fully defined functions in bacterial cell membranes. Protein sequence analysis suggests it contains multiple transmembrane domains characteristic of integral membrane proteins, potentially functioning in transport, signaling, or maintaining membrane integrity. Experimental approaches similar to those used in studying other membrane proteins in S. aureus strains like USA300 JE2 could provide insights into its specific cellular functions .

What experimental systems are most suitable for studying recombinant SAOUHSC_00567?

For effective study of recombinant SAOUHSC_00567, researchers should consider utilizing the well-characterized laboratory strain S. aureus USA300 JE2, which serves as a reliable genetic background for protein expression and functional studies . Expression systems should incorporate appropriate selectable markers such as erythromycin (25 μg/mL) to maintain recombinant constructs, similar to techniques used for other S. aureus proteins . Growth conditions should include standard media such as tryptic soy agar (TSA) or lysogeny broth (LB), with specialized media containing appropriate selectors required for specific experiments . Coculture experiments with other bacterial species, particularly Pseudomonas aeruginosa, can provide valuable insights into the protein's role during interspecies interactions, following protocols similar to those developed for studying S. aureus survival in polymicrobial environments . For precise control of experimental conditions, chemically defined media with specific nutrient compositions (CDMG) can be utilized to evaluate the protein's function under various nutritional states .

How does protein location affect experimental approaches for SAOUHSC_00567 research?

The membrane localization of SAOUHSC_00567 necessitates specialized experimental approaches that address the challenges of working with hydrophobic membrane proteins. Protein extraction protocols must include appropriate detergents (such as Triton X-100 or n-dodecyl β-D-maltoside) to solubilize the protein while maintaining its structural integrity for downstream applications. Subcellular fractionation techniques are essential for confirming the protein's precise localization within the bacterial membrane system, requiring careful separation of cytoplasmic, membrane, and cell wall fractions. When designing recombinant expression systems, researchers should consider using expression vectors that include appropriate signal sequences to ensure proper membrane targeting and insertion, which is critical for functional studies. For structural studies, specialized approaches such as detergent screening, lipid cubic phase crystallization, or cryo-electron microscopy may be necessary to capture the protein in its native conformation. Functional characterization may require reconstitution into artificial membrane systems like liposomes or nanodiscs to study transport or signaling functions in a controlled environment.

What is the relationship between UPF factors and membrane protein quality control in S. aureus?

The potential relationship between UPF factors and membrane protein quality control in S. aureus represents an intriguing research direction based on parallels with known Upf complex functions. Research has demonstrated that Upf factors facilitate ubiquitin-dependent degradation of products derived from mRNAs containing premature termination codons (PTCs) . This quality control mechanism might extend to membrane proteins like SAOUHSC_00567, particularly if their transcripts contain regulatory features that interact with the Upf surveillance system. The efficiency of Upf complex recruitment to PTC-containing transcripts correlates with the decay rate of the resulting protein products, suggesting a direct involvement in protein quality control beyond mRNA surveillance . Studies in Saccharomyces cerevisiae have shown that the Upf complex promotes the degradation of unfolded proteins in a manner dependent on the presence of a faux 3'-UTR, which might have parallels in bacterial systems involving membrane proteins . Mass spectrometric and Western blot analyses have revealed associations between heat shock proteins (Hsp70) and PTC products, indicating a broader protein quality control network that might also function in S. aureus .

How might evolutionary adaptation experiments inform our understanding of SAOUHSC_00567 function?

Evolutionary adaptation experiments represent a powerful approach for understanding the functional significance of SAOUHSC_00567 in S. aureus survival and adaptation. Serial transfer evolution experiments, similar to those designed for studying S. aureus adaptation to P. aeruginosa, could reveal how SAOUHSC_00567 expression or sequence changes under selective pressure . These experiments typically involve repeatedly culturing S. aureus (using strains like USA300 JE2) with environmental stressors or competing organisms, followed by genomic and transcriptomic analysis to identify adaptive mutations . Filter-based coculture systems allow for controlled interaction between bacterial species while enabling easy separation for subsequent analysis, ideal for studying membrane protein adaptations in polymicrobial contexts . Population-level analysis of evolved S. aureus strains can identify convergent mutations in SAOUHSC_00567 or related genes, suggesting important functional roles in adaptation. Phenotypic characterization of evolved strains with mutations in SAOUHSC_00567 can provide insights into the protein's role in antibiotic resistance, virulence, or interspecies competition, particularly in the context of cystic fibrosis-related infections where multiple pathogens coexist .

What bioinformatic approaches can predict SAOUHSC_00567 interactions within cellular networks?

To predict SAOUHSC_00567 interactions within cellular networks, researchers should employ multiple complementary bioinformatic approaches, beginning with comparative genomic analysis across Staphylococcus species to identify conserved genetic contexts and co-evolution patterns that suggest functional associations. Protein-protein interaction prediction tools that integrate structural information, co-expression data, and evolutionary conservation can help identify potential binding partners for SAOUHSC_00567, particularly among other membrane proteins or components of secretion systems. Structural modeling using algorithms specifically designed for membrane proteins can predict three-dimensional conformations and potential binding sites, informing targeted mutagenesis experiments to validate functional domains. Gene co-expression network analysis using transcriptomic data from various growth conditions and stressors can reveal genes with expression patterns similar to SAOUHSC_00567, suggesting functional relationships. Metabolic network analysis may identify potential roles for SAOUHSC_00567 in specific biochemical pathways, particularly if it functions in transport or sensing of metabolites across the cell membrane. These computational predictions should ultimately guide experimental validation using approaches such as targeted mutagenesis, protein-protein interaction assays, or metabolomic profiling.

What coculture models best reveal SAOUHSC_00567 functions in polymicrobial settings?

For investigating SAOUHSC_00567 functions in polymicrobial settings, filter-based coculture systems provide excellent experimental control by allowing physical separation while permitting chemical communication between species. These systems utilize 0.45 μm membrane filters on solid media such as TSA, enabling researchers to place S. aureus expressing recombinant SAOUHSC_00567 in proximity to other bacterial species while facilitating separate recovery and analysis . Serial transfer evolution experiments can be designed to assess how SAOUHSC_00567 expression or mutations affect long-term adaptation to polymicrobial environments, requiring regular subculturing of S. aureus populations on Staphylococcus isolation agar (SIA) between coculture periods . For dynamic interaction studies, mixed liquid cultures with defined ratios of S. aureus to other species (such as the 1:30 ratio used in P. aeruginosa coculture studies) allow researchers to track population dynamics and competitive outcomes over time . Specialized chemically defined media (CDMG) with controlled nutrient availability can help identify whether SAOUHSC_00567 functions in nutrient acquisition or metabolite sensing during competition with other microorganisms . Population-level sequencing of S. aureus recovered from long-term coculture experiments can identify adaptive mutations in SAOUHSC_00567 or its regulatory elements, providing insights into its evolutionary importance in polymicrobial environments .

How can transposon mutagenesis be optimized for studying SAOUHSC_00567?

Transposon mutagenesis represents a powerful approach for studying SAOUHSC_00567 function, with specific methodological considerations to ensure success. Researchers should utilize established transposon systems compatible with S. aureus, such as those employed in the Nebraska Transposon Mutant Library (NTML), which has been successfully used to create targeted mutations in S. aureus USA300 JE2 . The transposition protocol should include selection on appropriate antibiotic media, with erythromycin (25 μg/mL) commonly used to select for transposon insertions in S. aureus . Confirmation of successful transposon insertion requires PCR amplification of the SAOUHSC_00567 locus, followed by sequencing to verify the precise location and orientation of the insertion, as demonstrated in protocols for other S. aureus genes . Transduced mutants should be validated using phage-mediated techniques, such as those employing phage φ11, which has proven effective for genetic manipulation of S. aureus strains . Phenotypic characterization of SAOUHSC_00567 transposon mutants should include growth curve analysis, antibiotic susceptibility testing, and coculture experiments to comprehensively assess the mutation's impact on cellular functions.

What are the recommended protocols for recombinant expression and purification of SAOUHSC_00567?

For successful recombinant expression and purification of SAOUHSC_00567, a comprehensive protocol should begin with codon optimization of the gene sequence for the chosen expression system, typically E. coli or S. aureus, to enhance translation efficiency and protein yield. Expression vector selection should incorporate appropriate fusion tags (such as His6, MBP, or GST) to facilitate purification while considering their potential impact on membrane protein folding and function. Induction conditions must be carefully optimized, with lower temperatures (16-25°C) and reduced inducer concentrations often beneficial for membrane protein expression to prevent aggregation and inclusion body formation. Membrane protein extraction requires specialized detergents, with an initial screening panel including mild options like n-dodecyl β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin to identify optimal solubilization conditions. Purification typically involves immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography, with all buffers containing the optimal detergent at concentrations above its critical micelle concentration. For functional studies, reconstitution into lipid bilayers or nanodiscs composed of lipid compositions mimicking S. aureus membranes may be necessary to maintain native protein conformation and activity.

How should researchers analyze contradictory findings about SAOUHSC_00567 functions?

When confronted with contradictory findings regarding SAOUHSC_00567 functions, researchers should implement a systematic analytical approach that begins with a comprehensive assessment of methodological differences between studies, including strain backgrounds, growth conditions, and experimental systems that might explain divergent results. Meta-analysis techniques can be applied to published data to identify trends and consistencies across multiple studies, potentially revealing specific conditions where contradictions arise and suggesting experimental variables that significantly impact outcomes. Researchers should consider the possibility that SAOUHSC_00567 exhibits context-dependent functions, potentially responding differently to various environmental stressors or growth phases, necessitating targeted experiments to map its functional landscape across conditions. Advanced statistical approaches, such as Bayesian network analysis, can integrate diverse datasets to identify conditional dependencies and causal relationships that might reconcile apparently contradictory findings. Collaborative validation studies involving multiple laboratories using standardized protocols represent a gold standard approach for resolving contradictions, similar to how consensus has been built for other challenging bacterial proteins. Additionally, researchers should consider alternative technical approaches – if functional studies yield contradictory results, structural or localization studies might provide indirect evidence to support particular functional models.

What statistical methods are appropriate for analyzing SAOUHSC_00567 expression data?

For robust analysis of SAOUHSC_00567 expression data, researchers should implement a multi-faceted statistical approach beginning with normalization methods appropriate to the data collection platform, such as RPKM/FPKM for RNA-seq data or reference gene normalization for qPCR, to account for technical variations between samples. Differential expression analysis should employ appropriate statistical tests based on data distribution characteristics, with limma, DESeq2, or edgeR commonly used for RNA-seq data, while ANOVA or non-parametric alternatives may be more suitable for qPCR data with smaller sample sizes. Time-series expression data should be analyzed using specialized methods such as maSigPro or EDGE that account for temporal dependencies and can identify significant expression patterns across experimental time points. Correlation analysis between SAOUHSC_00567 expression and phenotypic measurements can help establish functional relationships, with Pearson or Spearman coefficients selected based on whether relationships are expected to be linear or monotonic. When analyzing expression data from coculture experiments, mixed-effects models can account for the nested structure of the experimental design while controlling for batch effects and other variables. For all analyses, appropriate multiple testing correction methods (such as Benjamini-Hochberg) should be applied to control false discovery rates, particularly when screening for correlations across large datasets.

How can SEO and search analysis inform SAOUHSC_00567 research priorities?

Search engine optimization (SEO) and analysis of search patterns can provide valuable insights for guiding SAOUHSC_00567 research priorities by revealing knowledge gaps and areas of high interest in the scientific community. Analysis of Google's "People Also Ask" data can identify common research questions related to S. aureus membrane proteins that remain inadequately addressed in the literature, highlighting opportunities for high-impact studies . Tracking search trends over time can reveal emerging research directions and fluctuations in interest regarding specific aspects of SAOUHSC_00567 function, such as its role in antimicrobial resistance or virulence . Understanding the prevalence of question-based searches (those beginning with what, how, why, when, who) can help researchers frame their findings in ways that directly address the most common scientific inquiries, improving the visibility and impact of their work . Analyzing the position and frequency of SAOUHSC_00567-related content in search results can identify which aspects of this protein's biology are well-covered versus underrepresented in the accessible scientific literature . Researchers can leverage this information to develop targeted research programs addressing knowledge gaps while avoiding redundancy with well-established areas, ultimately optimizing research resource allocation and impact.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.