Recombinant Staphylococcus aureus UPF0382 membrane protein SAS0541 (SAS0541)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SAS0541; UPF0382 membrane protein SAS0541
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Staphylococcus aureus (strain MSSA476)
Target Names
SAS0541
Target Protein Sequence
MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWIMLIIATFKF AG
Uniprot No.

Target Background

Database Links

KEGG: sas:SAS0541

Protein Families
UPF0382 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most suitable for recombinant UPF0382 membrane protein SAS0541 production?

Recombinant UPF0382 membrane protein SAS0541 from Staphylococcus aureus can be effectively expressed in several host systems, each offering distinct advantages depending on research objectives . Escherichia coli and yeast expression systems generally provide the highest yields and shortest turnaround times, making them particularly suitable for initial characterization studies and high-throughput screening applications . For E. coli-based expression, BL21(DE3) and its derivatives are frequently employed due to their reduced protease activity and compatibility with T7 promoter-driven expression vectors.

For researchers requiring post-translational modifications necessary for proper protein folding and activity, insect cell expression using baculovirus vectors or mammalian cell expression systems are recommended alternatives . These eukaryotic expression systems can provide more authentic processing of membrane proteins, although at the cost of lower yields and longer production times compared to prokaryotic systems. When selecting an expression system, researchers should consider the downstream applications, required protein purity, and whether native conformation is essential for the planned experiments.

The choice of expression system should be informed by the specific experimental requirements, particularly considering that membrane proteins often present challenges in expression and purification due to their hydrophobic domains. Pilot expression trials comparing multiple systems are recommended before scaling up production for comprehensive structural or functional studies.

What purification methods are effective for isolating UPF0382 membrane protein SAS0541?

Purification of recombinant UPF0382 membrane protein SAS0541 typically employs a multi-step approach designed to maintain protein stability while achieving high purity . Affinity chromatography using histidine tags represents the most common initial purification step, with nickel or cobalt immobilized metal affinity chromatography (IMAC) being particularly effective for capturing the target protein from crude lysates . The addition of a histidine tag to the recombinant construct facilitates this approach while minimally impacting protein structure and function in most cases.

Following initial capture, size exclusion chromatography (SEC) is frequently employed as a polishing step to separate the target protein from aggregates and other contaminants based on molecular size . For membrane proteins like UPF0382 SAS0541, purification buffers typically contain mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) to maintain protein solubility and prevent aggregation during the purification process. The selection of appropriate detergents is critical, as they must effectively solubilize the membrane protein while preserving its native conformation and functional properties.

Quality assessment of the purified protein is typically performed using SDS-PAGE and mass spectrometry, with purity levels exceeding 90% generally considered suitable for most downstream applications including structural studies and functional assays . Western blotting with antibodies against the histidine tag or the protein itself provides additional confirmation of identity and integrity. For particularly sensitive applications such as crystallography or cryo-electron microscopy, additional purification steps may be necessary to achieve the required homogeneity.

How can researchers verify the correct folding and functionality of recombinant UPF0382 membrane protein?

Verifying the correct folding and functionality of recombinant UPF0382 membrane protein SAS0541 requires multiple complementary approaches to assess both structural integrity and biological activity . Circular dichroism (CD) spectroscopy provides valuable information about secondary structure content, allowing researchers to confirm that the recombinant protein exhibits the expected α-helical patterns typical of membrane proteins. Thermal stability assays using differential scanning fluorimetry can further assess protein folding by monitoring unfolding transitions in response to increasing temperature.

Functional verification typically relies on biochemical assays specific to the protein's known or predicted activities. While the precise function of UPF0382 membrane protein SAS0541 remains under investigation, researchers can develop activity assays based on structural homology to better-characterized members of the protein family . These may include assessing membrane association properties, lipid binding affinities, or interactions with other Staphylococcus aureus proteins involved in related cellular processes.

Native mass spectrometry and size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) offer additional approaches to assess oligomerization state and homogeneity of the purified protein. For comprehensive structural validation, more advanced techniques such as limited proteolysis coupled with mass spectrometry can identify accessible regions consistent with proper folding, while nuclear magnetic resonance (NMR) spectroscopy can provide detailed information about the three-dimensional structure in solution. Each of these methods contributes complementary information to build confidence in the structural and functional integrity of the recombinant protein preparation.

How does UPF0382 membrane protein compare structurally to other membrane proteins in S. aureus?

The UPF0382 membrane protein SAS0541 belongs to a family of membrane proteins found in Staphylococcus aureus with distinct structural features that set it apart from other membrane proteins in this pathogen . Comparative structural analysis using bioinformatics approaches reveals that UPF0382 proteins contain predicted transmembrane domains arranged in a specific topology that distinguishes them from other membrane protein families. While comprehensive structural data specifically for SAS0541 remains limited, inferences can be drawn from related UPF0382 family members that have been better characterized.

Unlike the well-studied GpsB protein, which localizes to the division septum and interacts with FtsZ to facilitate cell division in S. aureus, UPF0382 membrane proteins appear to have distinct localization patterns and interaction partners . GpsB travels to the middle of the bacterium just before cell division and helps activate FtsZ, a core component of bacterial cell division machinery . In contrast, UPF0382 membrane proteins are believed to have different functional roles, potentially related to membrane integrity or transport processes, based on their predicted structural features and conservation patterns.

Structural prediction algorithms suggest that UPF0382 membrane proteins contain multiple α-helical transmembrane segments with intervening loop regions that may be involved in protein-protein interactions or substrate binding. These predicted structural elements can be experimentally validated using techniques such as site-directed spin labeling coupled with electron paramagnetic resonance (EPR) spectroscopy or hydrogen-deuterium exchange mass spectrometry. Such approaches provide valuable insights into the membrane topology and structural dynamics of these proteins without requiring high-resolution crystal structures, which remain challenging to obtain for many membrane proteins.

What role might UPF0382 membrane protein SAS0541 play in S. aureus pathogenesis and antibiotic resistance?

The potential role of UPF0382 membrane protein SAS0541 in Staphylococcus aureus pathogenesis and antibiotic resistance represents an important area of investigation, particularly given the increasing prevalence of multidrug-resistant strains . While direct evidence linking SAS0541 to virulence or antibiotic resistance mechanisms remains limited, several lines of indirect evidence suggest possible functions in these processes based on its membrane localization and conservation across pathogenic strains.

Unlike the chemotaxis inhibitory protein CHIPS, which directly counters host defense mechanisms by inhibiting neutrophil and monocyte responses to complement anaphylatoxin C5a and formylated peptides, UPF0382 membrane proteins may contribute to pathogenesis through different mechanisms . Their potential roles could include maintaining membrane integrity under stress conditions encountered during infection, facilitating nutrient acquisition in the host environment, or contributing to biofilm formation—a key virulence factor for S. aureus that enhances antibiotic tolerance and immune evasion.

To investigate these potential functions, researchers can employ gene knockout or knockdown approaches combined with phenotypic assays measuring virulence factor production, biofilm formation capacity, and susceptibility to various classes of antibiotics. Additionally, protein-protein interaction studies using techniques such as bacterial two-hybrid systems or co-immunoprecipitation followed by mass spectrometry can identify interaction partners that may provide clues to the protein's function in pathogenesis pathways. Transcriptomic and proteomic profiling comparing wild-type strains to those with altered UPF0382 protein expression under infection-relevant conditions can further elucidate its regulatory roles in virulence networks.

What experimental approaches are most effective for studying protein-protein interactions involving UPF0382 membrane protein?

Studying protein-protein interactions involving membrane proteins like UPF0382 SAS0541 presents unique challenges that require specialized experimental approaches . Crosslinking mass spectrometry represents a powerful technique for capturing transient interactions in their native membrane environment. This approach involves treating intact bacterial cells or membrane preparations with chemical crosslinkers that covalently link proteins located in close proximity, followed by purification and mass spectrometric analysis to identify interaction partners.

Fluorescence-based techniques have proven particularly valuable for studying membrane protein interactions in Staphylococcus aureus. For instance, researchers investigating GpsB in S. aureus used fluorescent labeling to track its movement to the middle of the bacterium during cell division and its interaction with FtsZ . Similar approaches combining fluorescent protein fusions with high-resolution microscopy techniques such as total internal reflection fluorescence (TIRF) or stimulated emission depletion (STED) microscopy can visualize the spatial and temporal dynamics of UPF0382 membrane protein interactions within the bacterial cell.

Genetic approaches offer complementary insights into functional interactions. Synthetic genetic arrays, in which the gene encoding UPF0382 membrane protein is systematically combined with mutations in other S. aureus genes, can identify genetic interactions suggesting functional relationships. These can be further validated using biochemical approaches such as pull-down assays with recombinant proteins. For investigating specific interactions, surface plasmon resonance (SPR) or microscale thermophoresis (MST) provides quantitative binding parameters when performed with purified components reconstituted in appropriate membrane-mimetic environments. The combination of these diverse approaches enables a comprehensive characterization of the protein interaction network involving UPF0382 membrane protein.

What are the optimal fermentation conditions for high-yield production of UPF0382 membrane protein?

Optimizing fermentation conditions for high-yield production of recombinant UPF0382 membrane protein SAS0541 requires careful consideration of multiple parameters that significantly impact protein expression levels and quality . Based on comparative studies of single-use and reusable fermentors for recombinant protein production, several key parameters have been identified as critical for successful membrane protein expression.

Temperature control represents one of the most influential parameters, with lower temperatures during the induction phase often beneficial for membrane protein production . While initial growth phases typically proceed at 37°C to maximize biomass accumulation, reducing the temperature to 25-30°C during protein induction can significantly improve the yield of correctly folded membrane proteins by slowing expression rates and allowing sufficient time for proper membrane insertion and folding . This approach has proven effective for other recombinant proteins expressed in bacterial systems, as demonstrated in comparative fermentation studies.

Dissolved oxygen (DO) levels must be carefully maintained throughout the fermentation process, with optimal setpoints typically between 30-60% saturation . The following table summarizes recommended fermentation parameters based on comparative studies of recombinant protein production in different fermentor systems:

ParameterGrowth PhaseInduction PhaseNotes
Temperature37°C25-30°CLower temperatures during induction improve membrane protein folding
Agitation600 RPM400-500 RPMReduced agitation during induction minimizes shear stress
pH7.2 ± 0.17.2 ± 0.1Maintained with 1.6M NaOH or 0.8M H₂SO₄
Dissolved Oxygen30-60%30-60%Critical for proper membrane protein expression
Induction Method-IPTG (0.5-1.0 mM) or AutoinductionAutoinduction may provide better yields for membrane proteins

Media composition also significantly impacts membrane protein yields, with supplementation of specific lipids or membrane components sometimes beneficial for enhancing expression of correctly folded membrane proteins. Monitoring protein expression through SDS-PAGE analysis of samples taken at regular intervals during fermentation allows for optimization of harvest timing to maximize yields of the target protein .

How can researchers accurately assess the purity and integrity of recombinant UPF0382 membrane protein preparations?

Accurate assessment of purity and integrity is essential for ensuring reliable results in downstream applications of recombinant UPF0382 membrane protein SAS0541 . Multiple complementary analytical techniques should be employed to comprehensively evaluate different aspects of protein quality.

Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) provides the primary method for assessing protein purity, with recombinant preparations ideally showing a single predominant band corresponding to the expected molecular weight of UPF0382 membrane protein with any affinity tags . Densitometric analysis of Coomassie-stained gels can quantify purity, with values exceeding 90% typically considered suitable for most research applications . For more sensitive analyses, silver staining can detect trace contaminants below the detection limit of Coomassie staining.

Mass spectrometry offers more definitive characterization of protein identity and integrity. Liquid chromatography-mass spectrometry (LC-MS) of intact proteins can verify the correct molecular weight of the full-length protein and identify any major truncation products or post-translational modifications. Peptide mass fingerprinting following proteolytic digestion provides sequence coverage information, confirming protein identity and potentially revealing regions of the protein that may be modified or degraded. These approaches can detect subtle changes in protein composition that might not be apparent by gel electrophoresis alone.

What advanced structural characterization techniques are most suitable for UPF0382 membrane proteins?

Structural characterization of UPF0382 membrane proteins presents unique challenges due to their hydrophobic nature and requirement for membrane-mimetic environments . Multiple complementary advanced techniques can be employed to obtain different levels of structural information, each with distinct advantages for membrane protein analysis.

X-ray crystallography remains the gold standard for high-resolution structure determination but requires well-diffracting crystals, which are notoriously difficult to obtain for membrane proteins. Recent advances in lipidic cubic phase (LCP) crystallization have improved success rates for membrane proteins, making this approach worth pursuing for UPF0382 membrane proteins. The resulting structures, when successful, provide atomic-level details of protein architecture, including the arrangement of transmembrane helices and the nature of any binding pockets or interaction interfaces.

Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative that avoids the need for crystallization. For UPF0382 membrane proteins, reconstitution into nanodiscs or amphipols prior to vitrification can maintain a native-like membrane environment during analysis. While traditionally limited for smaller proteins, recent advances in detector technology and image processing algorithms have continuously pushed the size limits downward, potentially bringing UPF0382 membrane proteins (depending on their size) within reach of this technique.

Nuclear magnetic resonance (NMR) spectroscopy offers unique advantages for studying membrane protein dynamics and interactions in solution. For UPF0382 membrane proteins, solid-state NMR approaches using proteins reconstituted into lipid bilayers can provide valuable restraints on protein structure while maintaining a native-like environment. This approach is particularly valuable for determining the topology of transmembrane segments and identifying flexible regions that may be involved in function.

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides complementary information about protein dynamics and solvent accessibility with lower sample requirements than crystallography or NMR. This technique measures the rate of hydrogen-deuterium exchange in different regions of the protein, revealing information about secondary structure stability and conformational changes that might occur upon ligand binding or protein-protein interactions.

What are common challenges in expressing UPF0382 membrane proteins and how can they be overcome?

Expression of UPF0382 membrane proteins frequently encounters several challenges that require systematic troubleshooting approaches . Protein toxicity represents a common issue, where overexpression of the membrane protein disrupts host cell membrane integrity or cellular processes. This typically manifests as poor growth following induction or gradual loss of expression plasmids during culture. To address this challenge, researchers can implement tightly regulated expression systems with lower basal expression, such as the T7-lac promoter system with glucose repression, or employ specialized E. coli strains designed for toxic protein expression, such as C41(DE3) or C43(DE3).

Protein misfolding and aggregation frequently occur with membrane proteins expressed at high levels, resulting in inclusion body formation rather than proper membrane integration . Several strategies can mitigate this issue: (1) reducing expression temperature during induction to 16-25°C, which slows protein synthesis and allows more time for proper folding; (2) co-expression with molecular chaperones such as GroEL/GroES or DnaK/DnaJ/GrpE, which assist in proper protein folding; and (3) fusion with solubility-enhancing tags such as MBP (maltose-binding protein) or SUMO (small ubiquitin-like modifier), which can improve folding efficiency and membrane integration.

Inadequate detergent selection for extraction and purification represents another significant challenge . Different membrane proteins require specific detergents for efficient solubilization while maintaining native structure and function. Researchers should conduct detergent screening experiments comparing mild detergents (DDM, LMNG), zwitterionic detergents (CHAPS, Fos-choline), and newer amphipathic polymers (amphipols, nanodiscs) to identify optimal conditions for UPF0382 membrane protein extraction and stability. Initial screening can use fluorescence-based thermal stability assays to rapidly identify conditions that preserve protein folding.

Low expression yields remain a persistent challenge with membrane proteins, requiring optimization of multiple parameters simultaneously . Implementing a design of experiments (DOE) approach enables systematic evaluation of key variables including expression strain, media composition, induction conditions, and harvest timing. High-throughput small-scale expression trials can efficiently identify optimal conditions before scaling up to larger fermentation volumes.

How can researchers distinguish between functional and non-functional forms of recombinant UPF0382 membrane protein?

Distinguishing between functional and non-functional forms of recombinant UPF0382 membrane protein requires multiple complementary approaches that assess different aspects of protein structure and activity . Functional verification begins with biophysical characterization to confirm proper folding. Circular dichroism (CD) spectroscopy provides information about secondary structure content, with properly folded UPF0382 membrane proteins expected to show characteristic α-helical signatures with minima at 208 and 222 nm. Thermal denaturation profiles monitored by CD or differential scanning fluorimetry (DSF) can further assess protein stability, with functional proteins typically exhibiting cooperative unfolding transitions.

Fluorescence-based approaches offer valuable insights into membrane protein folding and functionality . Intrinsic tryptophan fluorescence can detect conformational changes in response to ligand binding or environmental conditions, while extrinsic fluorescent probes sensitive to hydrophobic environments can assess membrane integration. These techniques are particularly useful for comparative analysis under different purification or storage conditions to identify those that best preserve protein functionality.

The gold standard for confirming functionality often involves complementation assays, in which the recombinant protein is expressed in bacterial strains lacking the endogenous protein to determine if it can restore wild-type phenotypes . For UPF0382 membrane proteins, this might involve expressing the recombinant protein in S. aureus strains with the corresponding gene deleted, then assessing restoration of growth, membrane integrity, or other relevant phenotypes. Such functional complementation provides compelling evidence that the recombinant protein has adopted its native, functional conformation.

What statistical approaches are recommended for analyzing structural and functional data from UPF0382 membrane protein studies?

For functional assays such as binding studies or activity measurements, replicate experiments are essential, with a minimum of three independent biological replicates recommended to account for experimental variability . Statistical comparison between wild-type and mutant proteins or between different experimental conditions should employ appropriate tests based on data distribution properties. For normally distributed data, parametric tests such as t-tests (for two-group comparisons) or ANOVA (for multiple groups) are appropriate, while non-parametric alternatives such as Mann-Whitney or Kruskal-Wallis tests should be used when normality cannot be assumed.

Dose-response experiments evaluating ligand binding or inhibition should be analyzed using appropriate curve-fitting models, typically employing nonlinear regression to estimate parameters such as EC50/IC50 values, Hill coefficients, or binding constants . Model selection should be guided by mechanistic considerations and statistical criteria such as Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC) to avoid overfitting. Confidence intervals for fitted parameters provide important information about estimation precision and should always be reported alongside point estimates.

For complex datasets involving multiple variables, multivariate statistical approaches such as principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) can reveal patterns and relationships that might not be apparent from univariate analyses. These techniques are particularly valuable for analyzing spectroscopic data or results from high-throughput screening experiments. Regardless of the analytical approach, researchers should clearly report all statistical methods, including software used, significance thresholds, and corrections for multiple comparisons when applicable.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.