Recombinant Staphylococcus aureus UPF0754 membrane protein SAS1767 (SAS1767)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development to meet your specifications.
Synonyms
SAS1767; UPF0754 membrane protein SAS1767
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-374
Protein Length
full length protein
Species
Staphylococcus aureus (strain MSSA476)
Target Names
SAS1767
Target Protein Sequence
MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLDQHVDNATDLLCDRARNYLSSAK GTQDINDMLDTFFNEKGKLFGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASKQANKPVVTLMPQFVDYLEGQLSSKL ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG GIIGFFQGLVAIFV
Uniprot No.

Target Background

Database Links

KEGG: sas:SAS1767

Protein Families
UPF0754 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining SAS1767 stability?

To maintain structural and functional integrity of recombinant SAS1767, implement the following evidence-based storage protocol:

Storage PurposeTemperatureDurationAdditional Notes
Regular storage-20°CMonthsIn Tris-based buffer with 50% glycerol
Extended storage-80°CYearsAvoid repeated freeze-thaw cycles
Working aliquots4°CUp to one weekFor ongoing experiments

The protein requires storage in an optimized buffer that typically includes 50% glycerol as a cryoprotectant . It is crucial to avoid repeated freeze-thaw cycles, as membrane proteins are particularly susceptible to aggregation and denaturation during temperature fluctuations. Instead, prepare multiple single-use aliquots during initial purification.

How should researchers design experiments to study SAS1767 function in bacterial membranes?

A comprehensive experimental design for SAS1767 functional characterization should incorporate multiple complementary approaches:

  • Gene knockout and complementation studies: Generate SAS1767 deletion mutants and complemented strains to establish phenotypic consequences.

  • Subcellular localization: Confirm membrane localization through fractionation experiments and immunoblotting with anti-His antibodies (for the recombinant protein).

  • Protein-protein interaction studies: Implement techniques such as bacterial two-hybrid assays, co-immunoprecipitation, and chemical crosslinking followed by mass spectrometry.

  • Functional reconstitution: Purify the protein and reconstitute in liposomes to study potential transport or structural functions.

  • Comparative genomics: Analyze SAS1767 conservation across Staphylococcus strains and related bacteria to infer functional importance.

For experimental design, establish experimental conditions using a mixed-method approach combining both quantitative and qualitative assessment techniques . Document all experimental variables systematically in an Experimental Design Data Set (EDDS) to facilitate rigorous analysis and ensure reproducibility .

What methodological approaches are most effective for studying SAS1767 interactions with host immune factors?

To investigate SAS1767 interactions with host immune components, implement this methodological framework:

  • In silico prediction: Begin with computational prediction of potential immune-interacting regions using epitope prediction algorithms and structural modeling.

  • Direct binding assays: Use surface plasmon resonance (SPR) or bio-layer interferometry (BLI) to quantify binding kinetics between purified SAS1767 and candidate immune factors.

  • Cell-based assays: Develop reporter systems in human immune cells to detect SAS1767-triggered signaling events.

  • Ex vivo exposure experiments: Expose human immune cells to purified SAS1767 and analyze transcriptomic and proteomic changes.

  • In vivo studies: Compare immune responses to wild-type and SAS1767-deficient S. aureus strains in appropriate animal models.

This multilayered approach aligns with established research methodology principles and enables both identification and validation of immune interactions. When working with recombinant SAS1767, always confirm proper folding through circular dichroism or other biophysical techniques to ensure observed interactions reflect native protein behavior.

How can researchers effectively design expression systems for obtaining high-quality recombinant SAS1767?

Membrane proteins present unique challenges for recombinant expression. Implement this systematic approach:

  • Construct optimization:

    • Test multiple expression vectors with different promoter strengths

    • Evaluate various fusion tags (His, MBP, SUMO) for enhanced solubility

    • Consider codon optimization for the expression host

  • Expression host selection:

    • Compare standard E. coli strains (BL21, C41/C43 specifically designed for membrane proteins)

    • Evaluate eukaryotic systems for complex membrane proteins

  • Expression condition optimization matrix:

ParameterVariables to TestMonitoring Method
Temperature16°C, 25°C, 37°CSDS-PAGE, Western blot
Inducer concentration0.1-1.0 mM IPTGYield quantification
Media compositionLB, TB, autoinductionGrowth curves, yield
Induction timingEarly, mid, late log phaseProtein quality assessment
  • Purification strategy:

    • Screen multiple detergents for solubilization

    • Implement two-step purification (IMAC followed by size exclusion)

    • Test membrane scaffold proteins for nanodiscs

This methodological approach emphasizes systematic parameter optimization with appropriate controls to determine optimal conditions for high-yield, properly-folded SAS1767 production .

What statistical frameworks are appropriate for analyzing SAS1767 structure-function relationship data?

When investigating structure-function relationships of SAS1767, implement this statistical analysis framework:

  • For mutagenesis studies:

    • Use multiple regression analysis to correlate structural modifications with functional outcomes

    • Implement ANOVA with post-hoc tests for comparing multiple mutants

    • Apply non-parametric tests when data don't meet normality assumptions

  • For biophysical property correlations:

    • Use principal component analysis (PCA) to identify patterns across multiple parameters

    • Implement cluster analysis to group functionally similar mutants

    • Apply machine learning algorithms for complex multivariate relationships

  • For evolutionary conservation analysis:

    • Calculate position-specific conservation scores

    • Perform statistical tests for enrichment of conserved residues in functional regions

    • Use phylogenetic methods to trace evolutionary importance

The robustness of these analyses depends on proper experimental design documentation, as outlined in the EDDS approach . Ensure sufficient biological and technical replicates (minimum n=3 for each condition) and conduct appropriate power analysis before experiments to determine sample sizes needed for detecting meaningful effects.

How should researchers approach data reconciliation when different methods yield conflicting results about SAS1767 function?

Data conflicts are common in membrane protein research due to methodological limitations. Implement this systematic approach to resolve discrepancies:

  • Methodological evaluation:

    • Identify inherent limitations of each technique (detection limits, artifacts)

    • Assess experiment-specific variables that might affect outcomes

    • Review controls and normalization methods

  • Biological context analysis:

    • Consider protein conformational states under different experimental conditions

    • Evaluate buffer compositions and their effects on protein behavior

    • Assess potential post-translational modifications

  • Integrative analysis:

    • Develop computational models that can accommodate seemingly conflicting data

    • Weight evidence based on methodological strengths

    • Identify conditions where results converge

  • Targeted validation experiments:

    • Design experiments specifically to address the source of discrepancy

    • Use orthogonal methods to validate key findings

    • Implement controlled variable experiments isolating specific parameters

This mixed-method research approach allows for robust data interpretation even when initial results appear contradictory. Document all reconciliation steps thoroughly to ensure reproducibility and transparency in reporting.

How might SAS1767 be evaluated as a potential vaccine candidate against Staphylococcus aureus infections?

Evaluating SAS1767 as a vaccine candidate requires a systematic approach similar to other S. aureus vaccine development efforts:

  • Antigenicity assessment:

    • Perform epitope prediction analysis identifying potential B and T cell epitopes

    • Evaluate surface accessibility and conservation across clinically relevant strains

    • Analyze potential cross-reactivity with human proteins

  • Immunogenicity testing:

    • Test purified SAS1767 with various adjuvants in animal models

    • Evaluate antibody titers, isotype distribution, and durability

    • Assess T cell responses through cytokine profiling

  • Functional antibody assessment:

    • Perform opsonophagocytic assays similar to those used in evaluating the recombinant five-antigen Staphylococcus aureus vaccine (rFSAV)

    • Evaluate neutralization of potential virulence functions

    • Test antibody-dependent cellular cytotoxicity

  • Protection studies:

    • Challenge immunized animals with diverse S. aureus strains

    • Assess bacterial burden, dissemination, and survival rates

    • Compare with established vaccine candidates

  • Safety evaluation:

    • Conduct dose-ranging studies to identify optimal dosing

    • Monitor for adverse events following randomized controlled trial protocols similar to those used for rFSAV

This framework builds on established S. aureus vaccine development pipelines while specifically targeting SAS1767 as a novel antigen, potentially complementing existing vaccine candidates through a multi-antigen approach.

What computational approaches can predict the membrane topology and tertiary structure of SAS1767?

Given the challenges in experimentally determining membrane protein structures, computational approaches provide valuable insights:

  • Transmembrane domain prediction:

    • Apply multiple specialized algorithms (TMHMM, HMMTOP, Phobius)

    • Implement consensus prediction from multiple tools

    • Validate predictions through limited proteolysis experiments

  • Homology modeling:

    • Identify structural homologs through sequence and secondary structure similarity

    • Build models based on template structures with validation through Ramachandran plots and energy minimization

    • Refine models using molecular dynamics simulations

  • Ab initio modeling:

    • Use fragment-based approaches for regions without homologs

    • Apply specialized membrane protein folding algorithms

    • Validate through comparison with experimental data

  • Molecular dynamics simulations:

    • Embed predicted structures in simulated lipid bilayers

    • Assess stability and conformational changes over nanosecond timescales

    • Identify potential ligand binding sites and functional domains

These computational approaches provide working structural hypotheses that can guide experimental design, particularly for mutagenesis studies targeting predicted functional regions of SAS1767.

How can researchers address solubility and stability issues when working with recombinant SAS1767?

Membrane proteins like SAS1767 frequently present solubility challenges. Implement this systematic troubleshooting approach:

  • Expression optimization:

    • Reduce expression temperature (16-20°C) to slow folding

    • Test speciality E. coli strains (C41/C43) designed for membrane proteins

    • Evaluate co-expression with chaperones

  • Solubilization strategy optimization:

Detergent TypeExamplesOptimal for
Non-ionicDDM, Triton X-100Initial screening
ZwitterionicCHAPS, LDAOMaintaining activity
Steroid-basedDigitonin, GDNPreserving complexes
Polymer-basedSMA, DIBMANative lipid retention
  • Buffer optimization:

    • Screen pH ranges (typically 6.5-8.5)

    • Test stabilizing additives (glycerol, specific lipids)

    • Evaluate salt concentrations (100-500 mM)

  • Alternative approaches:

    • Consider membrane mimetic systems (nanodiscs, liposomes)

    • Test fusion partners specifically designed for membrane proteins

    • Evaluate cell-free expression systems

Store purified protein in Tris-based buffer with 50% glycerol at appropriate temperatures as indicated in the product information . Document all optimization steps systematically to establish reproducible protocols for future research.

What strategies can overcome challenges in structural characterization of SAS1767?

Structural characterization of membrane proteins requires specialized approaches:

  • X-ray crystallography optimization:

    • Screen detergent/lipid combinations systematically

    • Test in meso crystallization approaches (LCP)

    • Consider antibody fragment co-crystallization to stabilize structure

  • Cryo-EM preparation:

    • Optimize grid preparation (detergent concentration, blotting times)

    • Screen different support films and grid types

    • Consider using nanodiscs or amphipols for stability

  • Alternative structural approaches:

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Solid-state NMR for specific structural elements

    • Cross-linking mass spectrometry for domain organization

  • Integrative structural biology:

    • Combine low-resolution experimental data with computational models

    • Validate structures through functional mutagenesis

    • Use evolutionary coupling analysis to inform structure

These methodological approaches can overcome the inherent challenges in membrane protein structural biology, providing insights into SAS1767 structure even when high-resolution techniques prove challenging.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.