The Recombinant Staphylococcus aureus UPF0754 membrane protein USA300HOU_1839 (USA300HOU_1839) is a full-length protein expressed in Escherichia coli and fused with an N-terminal His tag. This protein is part of the UPF0754 family and is identified by the UniProt ID A8YY16. It consists of 374 amino acids and is available in a lyophilized powder form with a purity of greater than 90% as determined by SDS-PAGE .
The amino acid sequence of the Recombinant Staphylococcus aureus UPF0754 membrane protein USA300HOU_1839 is as follows:
MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLNQHVDNATDLLCDRARNYLSSAK GTQDINDMLDTFFNEKGKLIGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASKQANKPVVTLMPQFVDYLEGQLSSKL ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG GIIGFFQGLVAIFV .
For reconstitution, the protein should be briefly centrifuged to bring the contents to the bottom of the vial. It is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) is suggested for long-term storage at -20°C or -80°C .
KEGG: sax:USA300HOU_1839
UPF0754 membrane proteins represent a family of bacterial membrane proteins with conserved structures across multiple Staphylococcus species. In S. aureus, these proteins are embedded in the cellular membrane and may play roles in cellular processes that contribute to the pathogen's virulence and survival. The USA300HOU_1839 variant is specifically found in the USA300 strain, which is a predominant community-associated methicillin-resistant S. aureus (CA-MRSA) lineage. Understanding these membrane proteins provides insights into potential therapeutic targets and bacterial physiology .
The USA300HOU_1839 protein shares significant sequence homology with other S. aureus UPF0754 variants, such as SaurJH1_1933, SAHV_1831, and SAS1767. Based on available data, these proteins typically contain approximately 374 amino acids with characteristic hydrophobic transmembrane domains. The amino acid sequence of the related SaurJH1_1933 begins with "MNALFIIIIFMIVVGAIIGGIT..." and contains multiple hydrophobic regions consistent with its membrane-spanning function . Sequence alignment analysis typically reveals conserved domains that may be critical for protein function across different S. aureus strains.
Based on analysis of related UPF0754 membrane proteins, USA300HOU_1839 likely contains multiple transmembrane domains. The sequence pattern suggests an N-terminal region followed by alternating hydrophobic (membrane-spanning) and hydrophilic (loop) regions. Computational prediction models indicate approximately 5-7 transmembrane helices with both the N-terminal and C-terminal regions potentially located on opposite sides of the membrane. This topology is consistent with the amino acid composition observed in the SaurJH1_1933 variant, which contains segments with high hydrophobicity index values suitable for membrane integration .
For optimal expression in E. coli, consider the following protocol:
Select an appropriate expression vector containing a T7 or similar strong promoter.
Transform the construct into an expression strain optimized for membrane proteins (e.g., C41(DE3) or C43(DE3)).
Grow cultures at 37°C until OD600 reaches 0.6-0.8.
Reduce temperature to 18-20°C before induction.
Induce with 0.1-0.5 mM IPTG.
Continue expression for 16-20 hours at reduced temperature.
This approach minimizes inclusion body formation and improves the yield of correctly folded membrane protein. For membrane proteins like USA300HOU_1839, lower induction temperatures significantly improve proper folding and membrane integration .
Purification of USA300HOU_1839 typically requires a multi-step approach:
Membrane fraction isolation via differential centrifugation.
Solubilization using appropriate detergents (e.g., DDM, LDAO, or Triton X-100).
Affinity chromatography using the protein's tag (commonly His-tag).
Size exclusion chromatography for further purification.
This process typically yields preparations with ≥85% purity as determined by SDS-PAGE analysis . For higher purity applications, additional ion exchange chromatography may be incorporated. The choice of detergent is critical for maintaining protein stability and activity throughout the purification process.
For functional reconstitution into liposomes, researchers should follow this methodological approach:
Prepare lipid mixture (typically POPC/POPE at 3:1 ratio) dissolved in chloroform.
Evaporate solvent under nitrogen gas and form lipid film.
Hydrate lipid film with buffer containing purified USA300HOU_1839 protein.
Subject the mixture to freeze-thaw cycles (5-10 times).
Extrude through polycarbonate membranes (100-400 nm pore size).
Remove non-incorporated protein via density gradient centrifugation.
This protocol allows for controlled incorporation of the membrane protein into lipid bilayers, creating proteoliposomes suitable for functional assays including ion transport, ligand binding, or interaction studies with other membrane components .
To investigate protein-protein interactions involving USA300HOU_1839, several complementary approaches are recommended:
Co-immunoprecipitation (Co-IP) using antibodies against USA300HOU_1839 or potential interacting partners.
Proximity labeling techniques such as BioID or APEX2 fusion constructs.
Bimolecular fluorescence complementation (BiFC) for in vivo interaction validation.
Surface plasmon resonance (SPR) or microscale thermophoresis (MST) for quantitative interaction analysis.
Cross-linking mass spectrometry (XL-MS) to map interaction interfaces.
These methods provide different levels of information, from validating interactions to determining binding kinetics and identifying specific interaction domains. For membrane proteins like USA300HOU_1839, detergent selection and concentration are critical parameters that must be optimized to maintain native protein conformation while enabling detection of specific interactions .
Determining the structure of membrane proteins like USA300HOU_1839 presents unique challenges. The most suitable approaches include:
X-ray crystallography, which requires production of well-diffracting crystals:
Utilize lipidic cubic phase (LCP) crystallization.
Screen multiple detergents and additives.
Consider fusion proteins (e.g., T4 lysozyme) to enhance crystallization.
Cryo-electron microscopy (cryo-EM):
Particularly useful for larger membrane protein complexes.
Can visualize protein in near-native lipid environments using nanodiscs.
Nuclear magnetic resonance (NMR) spectroscopy:
Suitable for smaller domains or regions of the protein.
Requires isotopic labeling (15N, 13C, 2H).
Computational modeling approaches:
Homology modeling based on related structures.
Molecular dynamics simulations to predict dynamic properties.
Each method has specific advantages and limitations for membrane protein structural analysis, and often a combination of approaches yields the most comprehensive structural information .
Assessment of proper folding and stability for USA300HOU_1839 should include multiple complementary techniques:
Circular dichroism (CD) spectroscopy to evaluate secondary structure content.
Fluorescence spectroscopy to monitor tertiary structure properties.
Thermal shift assays to determine protein stability under various conditions.
Limited proteolysis to assess compact, folded domains.
Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to evaluate oligomeric state and homogeneity.
For membrane proteins specifically, additional methods include:
Tryptophan fluorescence quenching to assess membrane integration.
Detergent screening by differential scanning fluorimetry to identify stabilizing conditions.
Proper folding is typically indicated by monodisperse elution profiles, expected secondary structure content, and resistance to proteolytic degradation. Purity should be confirmed by SDS-PAGE, with expected levels ≥85% for most research applications .
To elucidate the physiological function of USA300HOU_1839, a systematic approach combining genetic, biochemical, and physiological methods is recommended:
Gene knockout or knockdown studies:
CRISPR-Cas9 or antisense RNA approaches to reduce expression
Phenotypic analysis of resulting mutants
Complementation experiments:
Expression of wild-type protein in knockout strains
Site-directed mutagenesis to identify critical residues
Transcriptomic analysis:
RNA-seq to identify co-regulated genes
Comparison of expression profiles between wild-type and mutant strains
Metabolomic profiling:
Identification of altered metabolic pathways in mutants
Isotope labeling to track specific metabolic processes
Interaction studies:
Pull-down assays to identify protein partners
Metabolite binding assays to identify potential substrates
These approaches should be conducted in physiologically relevant conditions, such as under various stresses that S. aureus encounters during infection processes .
UPF0754 membrane proteins are found across multiple bacterial species, with notable examples in Bacillus subtilis (yheB), Bacillus pumilus (BPUM_0927), Bacillus cereus (BCAH820_0954), and Anoxybacillus flavithermus (Aflv_2299). Comparative analysis reveals:
| Species | Protein Identifier | Sequence Identity* | Length (aa) | Notable Features |
|---|---|---|---|---|
| S. aureus USA300 | USA300HOU_1839 | 100% (reference) | ~374 | Multiple transmembrane domains |
| S. aureus JH1 | SaurJH1_1933 | ~99% | 374 | Highly conserved compared to USA300 variant |
| S. aureus subsp. aureus | SAHV_1831 | ~98% | 374 | Similar secondary structure prediction |
| B. subtilis | yheB | ~40-45% | ~385 | More divergent sequence, conserved topology |
| B. pumilus | BPUM_0927 | ~38-42% | ~390 | Divergent but functionally related |
| B. cereus | BCAH820_0954 | ~36-40% | ~388 | Lower sequence identity, similar hydropathy |
*Estimated sequence identity ranges based on typical conservation patterns within protein families .
This evolutionary conservation suggests functional importance, with the highest conservation observed within Staphylococcus species and more divergence in other genera, while maintaining similar membrane topology and predicted structural features.
The potential of USA300HOU_1839 as a vaccine component can be evaluated through the following research approaches:
Antigenicity assessment:
Epitope mapping to identify immunogenic regions
Analysis of conservation across clinical isolates
Evaluation of surface exposure in intact bacteria
Immunization studies:
Recombinant protein formulations with appropriate adjuvants
Design of fusion proteins combining multiple antigens
Testing protein-conjugate formulations similar to successful approaches used with capsular polysaccharides
Challenge models:
Evaluation of protection in various infection models
Assessment of correlates of protection (antibody titers, cellular responses)
Analysis of bacterial clearance mechanisms
Recent failures in S. aureus vaccine development suggest that single-antigen approaches may be insufficient. A multi-component strategy incorporating UPF0754 membrane proteins alongside other antigens could provide broader protection. Particularly promising is the "designer" glycoconjugate approach where bacterial proteins (like USA300HOU_1839) could be conjugated to capsular polysaccharides from the same organism, potentially increasing immunogenicity compared to traditional conjugates using carrier proteins from unrelated bacteria .
Development of high-quality antibodies against USA300HOU_1839 requires special considerations due to its membrane-embedded nature:
Antigen preparation strategies:
Use of peptide antigens from predicted extracellular loops
Purification of full-length protein in detergent micelles
Preparation of proteoliposomes displaying native conformation
Immunization protocols:
Multiple boost strategies to enhance response against weakly immunogenic epitopes
Use of specialized adjuvants suited for membrane protein antigens
Prime-boost strategies combining different antigen formats
Screening methodologies:
ELISA using properly folded protein in detergent micelles
Flow cytometry against intact bacterial cells
Immunofluorescence microscopy to confirm surface localization
Validation approaches:
Western blotting against native and denatured forms
Immunoprecipitation under native conditions
Functional blocking assays if the protein has known activity
The resulting antibodies can serve multiple research purposes, including localization studies, functional inhibition experiments, and potentially therapeutic applications if the antibodies show opsonizing or neutralizing activity .
When analyzing expression data for USA300HOU_1839, consider these statistical approaches:
For qPCR expression analysis:
Use 2^-ΔΔCt method for relative quantification
Apply ANOVA with post-hoc tests for multi-condition comparisons
Implement mixed-effects models for time-course experiments
For protein expression quantification:
Employ densitometry analysis with proper normalization
Use non-parametric tests when assumptions of normality cannot be met
Apply multiple comparison corrections (e.g., Bonferroni, FDR) when testing many conditions
For experimental design:
Implement power analysis to determine appropriate sample sizes
Use randomized block designs to control for batch effects
Include biological and technical replicates (minimum n=3)
Data should be organized in clear tables following scientific reporting standards, with independent variables (e.g., growth conditions, strain types) in the left column and dependent variables (e.g., expression levels) with corresponding trials in subsequent columns .
To properly evaluate environmental effects on USA300HOU_1839 expression, implement the following experimental design approach:
| Environmental Factor | Experimental Design | Measurement Methods | Controls |
|---|---|---|---|
| pH | Test range from 5.5-8.5 in 0.5 increments | qRT-PCR, Western blot | Housekeeping gene expression, total protein levels |
| Temperature | Range from 25°C to 42°C in 5°C increments | qRT-PCR, proteomics | Heat/cold shock proteins as control |
| Oxygen tension | Aerobic, microaerobic, anaerobic conditions | Transcriptomics, proteomics | Known oxygen-responsive genes |
| Nutrient limitation | Varying carbon, nitrogen, iron sources | RNA-seq, Western blot | Growth rate normalization |
| Antimicrobial exposure | Sub-MIC antibiotic concentrations | qRT-PCR, reporter assays | Established stress response genes |
For each condition:
Establish time course measurements at 0, 1, 2, 4, 8, and 24 hours
Include minimum three biological replicates per condition
Implement factorial designs to detect interaction effects
Use appropriate statistical analysis (two-way ANOVA, mixed models)
This systematic approach allows for comprehensive characterization of how USA300HOU_1839 expression responds to environmental cues, potentially revealing insights into its physiological role .