Recombinant Staphylococcus carnosus Accessory gene regulator protein B (agrB)

Shipped with Ice Packs
In Stock

Description

Structure and Production

Recombinant S. carnosus agrB is synthesized using heterologous expression systems, typically in Escherichia coli. Key structural features include:

  • N-terminal His-tag: Facilitates purification via affinity chromatography .

  • Full-length sequence: Comprises 191 amino acids (1–191aa) .

  • Transmembrane topology: Predicted to adopt a six-transmembrane domain (6TMD) structure, with hydrophilic regions in the cytoplasmic membrane .

PropertyValue
Molecular Weight~21.4 kDa (estimated from AA sequence)
Expression HostE. coli
Purification TagN-terminal His-tag
FormLyophilized powder

Functional Role in the agr System

AgrB in S. carnosus is homologous to its S. aureus counterpart, functioning as a transmembrane endopeptidase. Key roles include:

  • Processing AgrD: Cleaves the C-terminal region of AgrD, enabling thiolactone macrocycle formation to produce autoinducing peptides (AIPs) .

  • Quorum Sensing: AIPs bind to AgrC (a histidine kinase), activating a two-component system (AgrC/AgrA) that regulates virulence gene expression .

Mechanistic Insights:

  • AgrB forms stable complexes with AgrD, as shown by split-luciferase assays and Western blotting .

  • In S. aureus, AgrB dimerizes, with one monomer binding AgrD and the other facilitating cleavage .

AgrB-AgrD Interaction Dynamics

Studies using S. aureus models reveal:

  • Binding Specificity: AgrB interacts preferentially with the C-terminal region of AgrD, as demonstrated by luciferase complementation assays .

  • Membrane Localization: AgrD binds N-terminally to membranes, while AgrB stabilizes this interaction in detergent micelles .

Interaction PropertyObservation
Binding AffinityHigh-affinity interaction (C-terminal AgrB)
Structural StabilityAgrD enhances thermal stability of AgrB
Complex FormationDetected via SRCD and SAXS in vitro

Comparative Analysis with S. aureus agrB

While S. carnosus agrB shares functional homology with S. aureus agrB, key differences include:

  • Genome Context: S. carnosus lacks mobile genetic elements and has a smaller genome (2.56 Mbp) with higher GC content (34.6%) .

  • Agr Locus Diversity: The agr locus in S. carnosus is less polymorphic than in S. aureus, suggesting reduced evolutionary pressure .

Applications in Biomedical Research

Recombinant S. carnosus agrB serves as a non-pathogenic model for studying:

  • Quorum Sensing Mechanisms: Elucidating AgrB’s role in AIP production and cross-species signaling inhibition .

  • Protein Engineering: Designing AgrB variants for biotechnological applications, such as surface display systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
agrB; Sca_1545; Accessory gene regulator protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Staphylococcus carnosus (strain TM300)
Target Names
agrB
Target Protein Sequence
MQKVLERKIDAWAQALQKRNNLDRIAYLKIKLGLEVFFNNLFKTIVVYGLALLFHVFLYT LTVHLSYFAIRHYAHGAHAKSTFACYIESIILFVILPWILIKVDIPQIFMIVLAAVAFIL ICLYSPAITRKQPIPNHMRKKKKITAIFVAGILLIISFFIKQPFNELVQLGIVLIGAAQL PIFFPKQTKEG
Uniprot No.

Target Background

Function
AgrB, the accessory gene regulator protein B, plays a crucial role in the production of the autoinducing peptide (AIP), a signaling molecule essential for the quorum sensing system in Staphylococcus carnosus. This system regulates the expression of virulence factor genes. AgrB participates in the proteolytic processing of AgrD, the precursor of AIP.
Database Links
Protein Families
AgrB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus carnosus and how does it differ from pathogenic staphylococci?

Staphylococcus carnosus is a non-pathogenic gram-positive bacterium widely used in food manufacturing and as a research tool. Unlike pathogenic staphylococci, S. carnosus has several distinctive genomic characteristics:

  • Smaller genome size (2.56 Mbp) compared to other staphylococcal species

  • Higher GC content (34.6%) than other sequenced staphylococcal genomes

  • Asymmetric arrangement of ori and ter regions with replichores I (1.05 Mbp) and II (1.5 Mbp)

  • Absence of mobile genetic elements like plasmids, insertion sequences, transposons, or STAR elements

  • Reduced number of repeat sequences, suggesting high genome stability

  • Contains only one prophage (ΦTM300) and one genomic island (ΝSCA1)

  • Lacks multiple pathogenicity factors present in species like S. aureus and S. epidermidis

  • Lacks the oatA gene (peptidoglycan-specific O-acetyltransferase), making it lysozyme-susceptible

These characteristics contribute to its safety profile for research applications and food manufacturing.

What is the agr locus and its function in staphylococcal species?

The accessory gene regulator (agr) locus is a quorum-sensing system first identified in S. aureus that controls the production of exoproteins, many of which are involved in virulence in pathogenic species . The agr locus consists of two divergent operons expressed from promoters P2 and P3 . The P2 operon includes four genes (agrB, agrD, agrC, and agrA), of which:

  • agrD encodes the precursor of the autoinducing peptide (AIP)

  • agrB processes and exports AIP

  • agrC and agrA form a two-component signal transduction system that responds to AIP

The agr system has a complex pattern of action, upregulating certain extracellular toxins and enzymes expressed post-exponentially while repressing some exponential-phase surface components . This regulatory mechanism is widespread in staphylococci, with recognizable agr loci identified in at least 14 staphylococcal species or subspecies .

Why is S. carnosus particularly suitable for heterologous protein expression?

S. carnosus offers several advantages as a host for heterologous protein expression:

  • Non-pathogenic nature makes it safe for laboratory use and potential clinical applications

  • High genome stability due to the lack of mobile genetic elements

  • Efficient protein secretion and surface display capabilities

  • Well-established transformation protocols using protoplast transformation or electroporation

  • Availability of multiple plasmid vector systems

  • Demonstrated ability to efficiently express and display whole protein domains on its surface

  • Capacity to elicit humoral immune responses when displaying foreign antigens

  • Absence of extracellular protease activity that might degrade displayed proteins

These characteristics make S. carnosus particularly valuable for applications requiring stable expression of foreign proteins on the bacterial surface.

How can S. carnosus be used as a live vector for protein display?

S. carnosus can be engineered to display heterologous proteins on its cell surface through a novel expression system that combines:

  • Promoter and secretion signals from the Staphylococcus hyicus lipase gene, including a propeptide region

  • Cell wall-spanning and membrane-binding regions from protein A of Staphylococcus aureus

  • Optional reporter proteins such as serum albumin binding protein from streptococcal protein G

The system efficiently translocates and anchors foreign proteins to the cell wall of S. carnosus, as demonstrated by immunoblotting, immunogold staining, and immunofluorescence techniques on intact recombinant cells . For example, researchers have successfully displayed an 80-amino-acid peptide from a malaria blood stage antigen on the S. carnosus surface .

Importantly, the surface display of proteins on S. carnosus can be analyzed using fluorescence-activated cell sorting (FACS), providing a quantitative method to assess expression levels .

How can recombinant S. carnosus be used in vaccine development?

S. carnosus has shown promise as a live vector for vaccination, particularly for humoral vaccination strategies:

  • Recombinant S. carnosus can display whole domains of toxic proteins (such as the receptor-binding domain of diphtheria toxin, DTR) on its surface

  • When injected intraperitoneally into BALB/c mice, S. carnosus displaying DTR elicited significant anti-DT antibody responses

  • The resulting antisera successfully neutralized diphtheria toxin (DT) cytotoxicity in Vero cells

  • Increasing the proportion of heterologous protein displayed on the surface

  • Targeting the recombinant bacterium to appropriate cells of the immune system using specific antibodies

  • Optimization of the expression system, as S. carnosus has been successfully used for surface display of single-chain variable fragments of immunoglobulin (ScFv)

What methods are effective for transforming S. carnosus?

Unlike S. aureus, S. carnosus cannot be transformed using calcium-induced competence . The two established methods for transforming S. carnosus are:

  • Protoplast transformation: Involves removing the cell wall to create protoplasts that can take up DNA

  • Electroporation: Using electrical pulses to create temporary pores in the cell membrane

For effective transformation, several plasmid vector systems have been developed specifically for S. carnosus . These include:

  • pSE′mp18ABPXM for S. xylosus (but can be used in S. carnosus)

  • pSPPmABPXM specifically designed for S. carnosus

These vectors typically include features such as:

  • Chloramphenicol resistance (10 μg/ml) for selection in Staphylococcus species

  • Ampicillin resistance (200 μg/ml) for selection in E. coli (for cloning purposes)

  • Multicloning sites for insertion of target genes

  • Appropriate promoters and signal sequences for efficient expression and secretion

How can surface display of heterologous proteins on S. carnosus be verified?

Multiple complementary techniques can verify the surface display of heterologous proteins on S. carnosus:

  • Western blot analysis:

    • Detects production of the recombinant protein in bacterial lysates

    • Confirms correct size of fusion proteins

    • Example: Western blots with ABP-reactive antibodies detected immunoreactive products in lysates of S. carnosus containing pSPPmABPXM derivative plasmids

  • Surface binding assays:

    • Intact bacteria are incubated with antibodies specific to the inserted proteins

    • After washing, bound antibodies are detected with enzyme-conjugated secondary antibodies

    • Example: S. carnosus displaying DTR was efficiently recognized by ZZ-DTR antiserum but only weakly bound by control antiserum

  • Immunogold staining:

    • Electron microscopy technique using antibodies conjugated to gold particles

    • Provides direct visualization of the protein on the bacterial surface

  • Immunofluorescence:

    • Fluorescence microscopy using fluorophore-labeled antibodies

    • Allows visualization of surface-displayed proteins on intact cells

  • Fluorescence-activated cell sorting (FACS):

    • Quantitative analysis of surface-displayed proteins

    • First applied to gram-positive bacteria with S. carnosus

Using multiple methods provides complementary evidence for successful surface display and helps determine the efficiency of the display system.

How should experiments be designed to evaluate the immunogenicity of proteins displayed on S. carnosus?

Designing experiments to evaluate immunogenicity requires careful consideration of several parameters. Based on previous studies with S. carnosus displaying the diphtheria toxin receptor-binding domain (DTR), the following approach is recommended:

  • Immunization protocol:

    • Animal model selection: BALB/c mice have been successfully used

    • Route of administration: Intraperitoneal injection showed better results than subcutaneous injection

    • Dosage: Previous studies used 3 × 10^8 CFU of live recombinant bacteria

    • Immunization schedule: Test multiple frequencies (e.g., every 3-4 days, weekly, or biweekly)

    • Control groups: Include mice injected with S. carnosus containing empty vector

  • Sample collection:

    • Collect blood samples 2 weeks after the last injection

    • Prepare individual sera as well as pooled sera for analysis

  • Antibody response assessment:

    • Measure antigen-specific antibody titers using ELISA

    • Test individual sera to evaluate variability in immune response

    • Examine antibody isotype distribution for insights into the type of immune response

  • Functional assays:

    • Evaluate the neutralizing capacity of antibodies using appropriate in vitro assays

    • Example: Testing antisera's ability to neutralize diphtheria toxin cytotoxicity on Vero cells

  • Data analysis:

    • Compare antibody titers between different immunization schedules

    • Assess individual variability within groups

    • Correlate antibody levels with functional neutralization capacity

In the DTR study, nine injections administered every 3-4 days yielded anti-DT titers of 1/44,000, compared to 1/2,000 for weekly injections and 1/1,000 for biweekly injections . Individual sera within the most responsive group showed remarkably consistent titers (within 10% of the pooled value), indicating that S. carnosus can trigger homogeneous immune responses .

What techniques can be used to analyze variations in the agr locus across staphylococcal species?

The agr locus shows high genetic variability across staphylococcal species. Several techniques can be employed to analyze these variations:

  • PCR amplification with conserved primers:

    • Design primers targeting conserved regions that bracket variable sequences

    • Example: Primers targeting a ~1.2-kbp region including portions of agrB, agrC, and agrD

    • This approach successfully amplified agr loci from 14 of 34 staphylococcal species or subspecies tested

  • DNA sequencing and comparative analysis:

    • Sequence amplicons to identify distinct variants

    • Multiple alignment to identify conserved and variable regions

    • Example: Sequencing of 71 agr amplicons from 14 species identified 24 distinct variants with only 10% of nucleotides absolutely conserved

  • Protein signature analysis:

    • Examine conserved protein motifs and signatures

    • Example: Most variants retained several protein signatures, including the conserved cysteine residue of the autoinducing peptide (with one exception in S. intermedius from pigeon)

  • Functional group classification:

    • Group agr variants based on cross-activation or inhibition patterns

    • Example: S. aureus agr can be divided into four distinct genetic groups based on activation/inhibition patterns

  • Evolutionary analysis:

    • Examine patterns of conservation and variation to infer evolutionary relationships

    • Study co-evolution of interacting components (agrB, agrC, and agrD)

Such analyses have revealed that the agr locus maintains recognizable structure across staphylococcal species despite extensive sequence divergence, suggesting functional importance coupled with adaptation to species-specific requirements.

How do sequence variations in agrB affect its function in different staphylococcal species?

The agrB gene shows striking variability among staphylococcal species, particularly in the C-terminal two-thirds of the protein, which may be involved in the specific cleavage and transport of the autoinducing peptide (AIP) . This variability has significant functional implications:

  • Specificity of AIP processing:

    • The variable regions of agrB are thought to be involved in specific recognition and processing of its cognate agrD-encoded AIP precursor

    • Co-evolution of agrB and agrD allows for species-specific quorum sensing

    • The C-terminal region of agrB may contain specificity determinants for AIP recognition

  • Cross-species inhibition:

    • AIPs from different species or groups generally inhibit agr activity in other species

    • This creates a complex network of intra-species activation and inter-species inhibition

    • Despite sequence divergence, the mechanism for broad-spectrum inhibition is maintained

  • Surface display capabilities:

    • The ability to display proteins varies between species

    • For example, S. carnosus efficiently displays heterologous proteins on its surface, while S. xylosus shows much weaker display capabilities despite similar expression systems

    • This functional difference may relate to differences in membrane and cell wall architecture or to extracellular protease activity

  • Evolutionary implications:

    • Sequence analysis of agrB across staphylococcal species reveals extensive diversity with only 10% of nucleotides absolutely conserved

    • This suggests strong selective pressure for diversification while maintaining core functionality

    • The variability of agrB, agrC, and agrD, contrasted with the relative conservation of agrA, indicates specialized roles in signal specificity versus general response regulation

Understanding these variations and their functional consequences provides insights into the evolution of quorum sensing and could inform the design of interventions targeting these systems in pathogenic staphylococci.

What are the key considerations for optimizing heterologous protein display in S. carnosus?

Optimizing heterologous protein display in S. carnosus requires attention to several factors that can affect expression efficiency and functionality:

  • Vector design considerations:

    • Selection of appropriate promoters and signal sequences

    • Choice of cell wall anchoring domain

    • Inclusion of propeptide regions that may enhance secretion

    • Example: The propeptide region from Staphylococcus hyicus lipase (209 residues) significantly enhances display compared to the shorter propeptide from S. aureus protein A (10 residues)

  • Protein-specific factors:

    • Size and complexity of the heterologous protein

    • Presence of disulfide bonds or other post-translational modifications

    • Potential toxicity to the host cell

    • Example: S. carnosus successfully displayed an entire domain of diphtheria toxin (DTR, 17 kDa), demonstrating its capacity to handle potentially toxic proteins

  • Accessibility enhancement:

    • Use of spacer proteins to increase accessibility of the displayed protein

    • Addition of reporter molecules like serum albumin binding protein

    • Example: Incorporating albumin-binding reporter proteins both increased accessibility and provided a useful marker for detection

  • Expression verification methods:

    • Implementation of multiple complementary techniques (Western blot, immunofluorescence, FACS)

    • Use of appropriate controls to confirm surface localization versus cytoplasmic expression

  • Host strain considerations:

    • S. carnosus lacks extracellular protease activity that could degrade surface proteins

    • The strain has high genome stability, reducing the risk of mutations affecting expression

By systematically optimizing these parameters, researchers can develop efficient surface display systems for specific applications in vaccine development, protein engineering, or diagnostic tools.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.