Recombinant Staphylococcus carnosus Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preferred format in the order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this need in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize development of that specific tag.
Synonyms
plsY; Sca_0994; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Staphylococcus carnosus (strain TM300)
Target Names
plsY
Target Protein Sequence
MMIVLMLLLAYIVGSFPSGVIIGKIFFKKDIRQFGSGNTGATNSFRVLGRPAGFVVTFLD IFKGFIVVFFPLLFPVHPTGPISEFFTNGLIVGVFAILGHVYPIFLKFHGGKAVATSAGV VLGVAPILLLILAAIFFLTLYLTKYVSLSSIVAAICCVIGSLIIHDYILLVVSIIVAILL IFRHRTNIVRIFKGEEPKIKWM
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of Glycerol-3-phosphate acyltransferase (PlsY) in bacterial systems?

Glycerol-3-phosphate acyltransferase (PlsY) plays a critical role in bacterial membrane phospholipid biosynthesis. It catalyzes the transfer of acyl groups from acylphosphate to glycerol 3-phosphate, representing the most widely distributed biosynthetic pathway to initiate phosphatidic acid formation in bacterial membrane phospholipid biosynthesis. This process begins with the conversion of acyl-acyl carrier protein to acylphosphate by PlsX, followed by the transfer of the acyl group to glycerol 3-phosphate by PlsY, an integral membrane protein .

The importance of PlsY extends beyond basic metabolism; as a membrane-bound enzyme essential for bacterial survival, it represents a potential target for antimicrobial development. Research has demonstrated that disruption of phospholipid biosynthesis pathways can significantly impair bacterial growth and viability, making PlsY an attractive subject for both fundamental bacterial physiology studies and applied antimicrobial research.

How does Staphylococcus carnosus differ from pathogenic staphylococcal species, and why is it preferred for recombinant protein expression?

Staphylococcus carnosus offers several advantages as a non-pathogenic expression system compared to pathogenic staphylococcal species. The S. carnosus genome has distinct characteristics that make it particularly suitable for research applications:

FeatureS. carnosusPathogenic staphylococci (e.g., S. aureus)
Genome size2.56 Mbp (smaller)Generally larger
GC content34.6% (highest among staphylococci)Lower
Mobile genetic elementsLacks plasmids, insertion sequences, transposonsContains numerous mobile elements
Repeat sequencesMarkedly decreasedMore abundant
Genome stabilityComparatively highLower due to mobile elements
Lysozyme susceptibilitySusceptible (lacks oatA gene)Resistant
Pathogenicity factorsSignificantly fewerNumerous

S. carnosus has become the organism of choice for studying pathogenicity factors from other staphylococcal species, as it provides a "clean" background free from interfering factors. Researchers have successfully expressed numerous invasion factors, matrix-binding proteins, and virulence factors from pathogenic species in S. carnosus to study their function . Additionally, S. carnosus can be directly transformed with DNA isolated from E. coli, making genetic manipulation relatively straightforward compared to other staphylococcal species .

What are the standard methods for transforming Staphylococcus carnosus with recombinant PlsY constructs?

Transformation of S. carnosus with recombinant PlsY constructs typically employs protoplast transformation, which has been well-established for this organism. The methodology follows these key steps:

  • Preparation of competent S. carnosus protoplasts by enzymatic removal of the cell wall

  • Introduction of plasmid DNA containing the PlsY construct

  • Regeneration of the cell wall in appropriate media

  • Selection of transformants using appropriate markers

The search results indicate that S. carnosus can be directly transformed with DNA isolated from E. coli, which simplifies the cloning process significantly . This is in contrast to other staphylococcal species like S. gallinarum, which only accepts DNA of staphylococcal origin and requires an intermediate host such as S. aureus RN4220 for plasmid transfer .

For recombinant PlsY expression, researchers typically use vectors that include:

  • Strong, constitutive promoters or inducible systems

  • Appropriate signal peptides for protein secretion or membrane localization

  • Selection markers compatible with S. carnosus

  • Required regulatory elements for stable expression

For secretion of recombinant proteins, constructs can incorporate signal peptide sequences, as demonstrated in the literature with the signal peptide sequence from SceA (Sca_1598) and the transcriptional terminator of SceD (Sca_1599) .

What are the critical considerations for optimizing the expression and purification of functional recombinant PlsY in Staphylococcus carnosus?

Optimizing recombinant PlsY expression in S. carnosus requires careful consideration of several critical factors:

Membrane protein expression considerations:
PlsY is an integral membrane protein with five membrane-spanning segments, making its expression and purification particularly challenging . Researchers must account for proper membrane insertion, folding, and stability. The optimization process should address:

  • Expression vector design:

    • Selection of appropriate promoters (constitutive vs. inducible)

    • Inclusion of optimal ribosome binding sites

    • Consideration of codon optimization for S. carnosus

    • Addition of affinity tags (N-terminal vs. C-terminal) that don't interfere with protein function

  • Growth and induction conditions:

    • Optimal temperature (often lower temperatures improve membrane protein folding)

    • Media composition (including possible supplementation with lipids)

    • Induction timing and concentration (if using inducible systems)

    • Duration of expression

  • Membrane extraction and purification:

    • Selection of appropriate detergents for membrane solubilization

    • Detergent concentration optimization to maintain enzyme activity

    • Purification strategy (affinity chromatography, ion exchange, size exclusion)

    • Buffer composition to maintain stability

  • Activity preservation:

    • Careful selection of stabilizing agents during purification

    • Identification of lipid requirements for maintaining activity

    • Storage conditions optimization

Given PlsY's structure with five membrane-spanning segments and three larger cytoplasmic domains containing highly conserved sequence motifs , special attention must be paid to maintaining the native conformation during extraction and purification. The critical active site residues identified in each motif (serine and arginine in motif 1, glycines in motif 2, and histidine, asparagine, and glutamate in motif 3) must remain functional for enzymatic activity .

How can the substituted cysteine accessibility method (SCAM) be applied to determine the membrane topology of recombinant PlsY in Staphylococcus carnosus?

The substituted cysteine accessibility method (SCAM) represents a powerful approach for determining membrane protein topology, as demonstrated in studies of Streptococcus pneumoniae PlsY . Adapting this method for recombinant PlsY in S. carnosus requires careful experimental design:

Principles of SCAM for PlsY topology determination:

  • Site-directed mutagenesis preparation:

    • Construct a cysteine-less version of PlsY by replacing native cysteines with serine or alanine

    • Introduce single cysteine residues at specific positions throughout the protein sequence

    • Create a comprehensive set of single-cysteine mutants covering all potential membrane-spanning and loop regions

  • Expression and membrane preparation:

    • Express each cysteine mutant in S. carnosus

    • Prepare membrane vesicles with defined orientation (right-side-out or inside-out)

    • Verify expression levels and baseline activity of each mutant

  • Cysteine accessibility assay:

    • Treat intact cells or membrane vesicles with membrane-impermeable sulfhydryl reagents (e.g., MTSET, MTSES)

    • These reagents will only react with cysteines exposed to the external medium

    • For comprehensive mapping, perform parallel experiments with membrane-permeable reagents

  • Detection methods:

    • Monitor changes in enzyme activity following sulfhydryl modification

    • Use biotinylated sulfhydryl reagents for direct detection via Western blotting

    • Employ mass spectrometry to confirm modification sites

  • Data analysis and topology mapping:

    • Positions where cysteines are accessible to membrane-impermeable reagents from the outside identify externally exposed regions

    • Positions accessible only in inside-out vesicles identify cytoplasmic regions

    • Positions inaccessible to membrane-impermeable reagents in both orientations suggest transmembrane locations

Based on previous studies of S. pneumoniae PlsY, researchers should expect to find a topology with five membrane-spanning segments, with the amino terminus and two short loops located on the external face of the membrane, and three larger cytoplasmic domains containing the conserved sequence motifs essential for catalysis .

What strategies can be employed to investigate the interaction between recombinant PlsY and other enzymes in the phospholipid biosynthesis pathway in Staphylococcus carnosus?

Investigating the interactions between recombinant PlsY and other enzymes in the phospholipid biosynthesis pathway requires multi-faceted approaches combining genetic, biochemical, and biophysical methods:

1. Co-immunoprecipitation and pull-down assays:

  • Express PlsY with an affinity tag in S. carnosus

  • Use the tagged PlsY to pull down interacting partners from cell lysates

  • Identify interacting proteins by mass spectrometry

  • Confirm direct interactions with purified components in vitro

2. Bacterial two-hybrid systems:

  • Adapt bacterial two-hybrid systems for membrane protein interactions

  • Create fusion constructs with PlsY and potential partner proteins

  • Screen for interactions in heterologous hosts

  • Validate positive interactions with alternative methods

3. Fluorescence resonance energy transfer (FRET):

  • Generate fluorescent protein fusions with PlsY and potential partners

  • Express in S. carnosus and monitor for FRET signals in vivo

  • Use acceptor photobleaching or fluorescence lifetime imaging for quantification

4. Crosslinking studies:

  • Employ membrane-permeable crosslinkers of various lengths

  • Identify crosslinked protein complexes by mass spectrometry

  • Use site-specific crosslinkers to map interaction interfaces

5. Pathway reconstruction:

  • Reconstitute the phospholipid synthesis pathway in vitro with purified components

  • Measure kinetic parameters in the presence and absence of potential interacting proteins

  • Identify rate-limiting steps and potential regulatory interactions

6. Protein-lipid interactions:

  • Investigate binding of PlsY to specific membrane lipids using lipid overlay assays

  • Determine effects of membrane composition on enzyme activity

  • Create defined proteoliposomes with controlled lipid compositions

Of particular interest would be interactions between PlsY and PlsX, as these enzymes work sequentially in the pathway, with PlsX converting acyl-acyl carrier protein to acylphosphate, which is then used by PlsY to acylate glycerol 3-phosphate . Understanding this interaction could provide insights into substrate channeling mechanisms and pathway regulation in phospholipid biosynthesis.

What are common challenges in obtaining active recombinant PlsY, and how can they be addressed?

Obtaining active recombinant PlsY presents several challenges related to its nature as an integral membrane protein. Here are common issues and recommended solutions:

Challenge 1: Low expression levels

  • Cause: Membrane protein overexpression often leads to cellular toxicity and growth inhibition

  • Solutions:

    • Optimize expression using tightly controlled inducible promoters

    • Lower induction temperature (25-30°C instead of 37°C)

    • Use enriched media formulations specific for membrane protein expression

    • Consider cell-free expression systems for toxic proteins

    • Evaluate different fusion tags that may enhance folding and stability

Challenge 2: Inclusion body formation

  • Cause: Improper folding and aggregation of overexpressed membrane proteins

  • Solutions:

    • Reduce expression rate by lowering inducer concentration

    • Co-express molecular chaperones to assist proper folding

    • Test different fusion partners known to enhance solubility

    • Develop refolding protocols if inclusion bodies cannot be avoided

    • Explore different detergents for solubilization

Challenge 3: Loss of activity during purification

  • Cause: Detergent-mediated destabilization of membrane protein structure

  • Solutions:

    • Screen multiple detergents for extraction efficiency and activity preservation

    • Include lipids or lipid-like molecules during purification

    • Use stabilizing additives (glycerol, specific ions, reducing agents)

    • Minimize time between extraction and activity assays

    • Consider nanodiscs or other membrane mimetics for stabilization

Challenge 4: Difficulties in activity assays

  • Cause: Complex substrate requirements and detergent interference

  • Solutions:

    • Develop robust activity assays compatible with detergent presence

    • Consider reconstitution into proteoliposomes for activity measurements

    • Adapt established protocols from related enzymes like those in search result

    • Ensure sufficient substrate solubility in assay conditions

    • Include appropriate controls for non-enzymatic substrate degradation

Challenge 5: Protein instability

  • Cause: Removal from native membrane environment

  • Solutions:

    • Identify optimal storage conditions (temperature, buffer composition)

    • Add stabilizers like glycerol or specific lipids

    • Consider flash-freezing in small aliquots

    • Test protein stability in different detergent micelles

    • Explore protein engineering to identify more stable variants

A systematic approach to troubleshooting would involve creating a decision tree for each stage of expression and purification, with specific interventions based on observed outcomes. For example, if Western blot analysis shows low expression, researchers might adjust induction parameters before proceeding to extraction optimization.

How can recombinant Staphylococcus carnosus PlsY be utilized as a model system for studying membrane protein topology and function?

Recombinant S. carnosus PlsY offers an excellent model system for studying fundamental aspects of membrane protein topology and function for several reasons:

1. Well-characterized membrane topology:
PlsY's established structure with five membrane-spanning segments and defined cytoplasmic and extracellular regions provides a foundation for broader membrane protein studies. Researchers can:

  • Use the substituted cysteine accessibility method (SCAM) established for PlsY as a template for other membrane proteins

  • Investigate how membrane insertion mechanisms operate in different bacterial species

  • Study how topology influences function through systematic domain swapping experiments

  • Develop improved prediction algorithms based on experimentally verified topology

2. Conserved catalytic motifs for structure-function studies:
The three conserved motifs in PlsY's cytoplasmic domains serve as excellent subjects for:

  • Systematic mutagenesis to establish structure-function relationships

  • Investigating the evolutionary conservation of enzyme mechanisms

  • Developing general principles for membrane enzyme active site organization

  • Computational modeling and simulation of catalytic mechanisms

3. Heterologous expression advantages:
S. carnosus offers several benefits as an expression system:

  • Non-pathogenic status facilitates laboratory work without biosafety concerns

  • Relative simplicity of the genome (2.56 Mbp) with high stability

  • Established transformation protocols for genetic manipulation

  • Compatibility with E. coli cloning systems

  • Well-characterized secretion systems for protein engineering studies

4. Experimental approaches:
Several approaches can leverage S. carnosus PlsY as a model system:

The integration of these approaches can provide valuable insights not only into PlsY function but also into general principles of membrane protein organization, folding, and catalysis that extend beyond this specific enzyme system.

What are the most promising strategies for developing inhibitors of PlsY as potential antimicrobial agents using recombinant S. carnosus systems?

The development of PlsY inhibitors as potential antimicrobial agents can benefit significantly from recombinant S. carnosus expression systems. Here are strategic approaches for this research:

1. High-throughput screening platforms:
Recombinant S. carnosus PlsY can be used to establish robust screening systems:

2. Structure-guided inhibitor design:
Using knowledge of PlsY structure and active site organization :

  • Active site targeting:
    Focus on the three conserved motifs identified in PlsY:

    • Motif 1: Target the essential serine and arginine residues

    • Motif 2: Design compounds that interfere with the phosphate-binding loop

    • Motif 3: Develop molecules that disrupt the function of conserved histidine and asparagine

  • Transition state analogs:
    Design compounds that mimic the transition state of the acyltransferase reaction.

  • Competitive substrate analogs:
    Develop non-hydrolyzable analogs of acylphosphate or modified glycerol 3-phosphate structures.

3. Fragment-based drug discovery:

  • Screen fragment libraries against purified PlsY

  • Identify binding fragments using biophysical methods

  • Link or grow fragments to develop higher-affinity inhibitors

  • Utilize competition assays to confirm binding site

4. Comparative studies using S. carnosus:
The non-pathogenic nature of S. carnosus makes it ideal for comparative studies:

  • Express PlsY variants from different bacterial species in S. carnosus

  • Identify species-specific inhibitor profiles

  • Develop broad-spectrum or species-selective inhibitors

  • Use S. carnosus as a safe surrogate for testing inhibitors against pathogenic species

5. Counter-screening strategy:
To ensure selectivity, develop a panel of assays including:

  • Human acyltransferases to identify potential off-target effects

  • Other bacterial essential enzymes to assess specificity

  • Cytotoxicity assays in mammalian cells

6. Resistance development studies:
Utilize S. carnosus to understand potential resistance mechanisms:

  • Perform directed evolution under inhibitor selection pressure

  • Identify and characterize resistance mutations

  • Design inhibitors less prone to resistance development

  • Develop combination strategies targeting multiple steps in phospholipid biosynthesis

The non-competitive inhibition of PlsY by palmitoyl-CoA provides a natural starting point for inhibitor design, suggesting allosteric binding sites that could be exploited for antimicrobial development without directly competing with substrates.

What are the current technical limitations in studying recombinant PlsY, and what emerging technologies might overcome these barriers?

Current technical limitations in PlsY research and emerging technologies that might address them include:

Current Limitations:

  • Membrane protein structural determination:

    • Difficulty in obtaining sufficient quantities of purified, active protein

    • Challenges in crystallizing membrane proteins for X-ray crystallography

    • Detergent micelles potentially altering native protein conformation

    • Limited resolution in current structural models

  • Activity assay constraints:

    • Interference of detergents with enzyme activity measurements

    • Complex substrate preparation and stability

    • Challenges in maintaining enzyme stability during assays

    • Difficulties in real-time monitoring of lipid-modifying reactions

  • In vivo function analysis:

    • Essential nature of PlsY limiting genetic manipulation

    • Complex interplay with other phospholipid biosynthesis enzymes

    • Difficulties in measuring in vivo activity directly

    • Limited tools for spatial and temporal regulation studies

  • Expression and purification hurdles:

    • Variable expression levels between batches

    • Protein aggregation during membrane extraction

    • Loss of activity during purification steps

    • Challenges in scale-up for structural studies

Emerging Technologies and Solutions:

  • Advanced structural methods:

    • Cryo-electron microscopy:
      Has revolutionized membrane protein structural biology, requiring less protein and no crystallization

    • Microcrystal electron diffraction (MicroED):
      Allows structural determination from extremely small crystals

    • Solid-state NMR:
      Provides structural information in lipid environments closer to native conditions

    • Hydrogen-deuterium exchange mass spectrometry:
      Maps protein dynamics and ligand interactions without requiring crystals

  • Innovative expression systems:

    • Cell-free expression systems:
      Allow direct integration of synthesized membrane proteins into nanodiscs or liposomes

    • Synthetic minimal cells:
      Provide simplified backgrounds for functional studies

    • Controlled membrane protein production:
      Using ribosome engineering or specialized induction systems

  • Improved activity assays:

    • Label-free detection systems:
      Surface plasmon resonance or bio-layer interferometry for binding studies

    • Native mass spectrometry:
      Direct observation of enzyme-substrate complexes

    • Microfluidic platforms:
      Allowing high-throughput enzyme kinetics with minimal material

    • Single-molecule enzymology:
      Direct observation of individual catalytic events

  • In vivo tools:

    • Optogenetic and chemogenetic tools:
      For temporal control of enzyme activity

    • Proximity labeling techniques:
      Identifying interaction partners in native membranes

    • Advanced imaging:
      Super-resolution microscopy for localization studies

    • Genetic code expansion:
      Incorporation of reporter groups at specific positions

  • Computational approaches:

    • Advanced molecular dynamics simulations:
      Modeling enzyme-membrane interactions

    • Machine learning:
      Predicting protein-ligand interactions

    • Quantum mechanics/molecular mechanics (QM/MM):
      Detailed modeling of catalytic mechanisms

These emerging technologies promise to overcome current limitations and provide deeper insights into PlsY structure, function, and potential for therapeutic targeting.

How might comparative studies of PlsY across different bacterial species inform our understanding of phospholipid biosynthesis evolution and potential species-specific antimicrobial strategies?

Comparative studies of PlsY across bacterial species offer profound insights into phospholipid biosynthesis evolution and species-specific antimicrobial development strategies:

Evolutionary insights from comparative PlsY studies:

  • Sequence conservation patterns:

    • Core catalytic motifs (the three conserved motifs identified in PlsY ) versus variable regions

    • Correlation between sequence divergence and bacterial phylogeny

    • Identification of species-specific insertions or deletions

    • Evolutionary rate analysis to identify selection pressures

  • Structural adaptations:

    • Variations in membrane-spanning regions across species

    • Adaptations to different membrane compositions

    • Species-specific regulatory domains or interaction surfaces

    • Conservation of active site architecture despite sequence divergence

  • Functional variations:

    • Substrate preference differences between species

    • Kinetic parameter variations (Km, kcat) and their ecological significance

    • Differential regulation mechanisms

    • Variable interaction networks with other biosynthetic enzymes

Table: Comparative analysis of PlsY across bacterial phyla

Bacterial groupKey PlsY characteristicsMembrane compositionPotential targeting strategy
Firmicutes (e.g., S. carnosus, S. pneumoniae)Five membrane-spanning segments; three conserved cytoplasmic motifs Low G+C content; lysine-derived lipids commonTarget conserved serine/arginine in motif 1
Proteobacteria[Would need specific data]Diverse phospholipid composition[Species-specific approach based on data]
Actinobacteria[Would need specific data]High mycolic acid content[Species-specific approach based on data]
Bacteroidetes[Would need specific data]Unique sphingolipids in some species[Species-specific approach based on data]

Applications for antimicrobial development:

  • Broad-spectrum vs. narrow-spectrum targeting:

    • Target highly conserved catalytic residues for broad-spectrum activity

    • Exploit species-specific active site variations for selective targeting

    • Design inhibitors matching unique substrate preferences of specific pathogens

    • Utilize differences in allosteric regulation for selective inhibition

  • Resistance barrier assessment:

    • Compare natural sequence variations to predict resistance mutation pathways

    • Identify highly constrained residues as targets with high resistance barriers

    • Develop combination strategies targeting different aspects of phospholipid synthesis

    • Study natural PlsY variants with altered inhibitor sensitivity

  • Model system development:

    • Use S. carnosus as a safe heterologous expression system for PlsY variants

    • Create chimeric enzymes to investigate specificity determinants

    • Develop species-tailored screening systems for inhibitor discovery

    • Establish correlations between in vitro activity and in vivo efficacy across species

The comparative approach leveraging S. carnosus as a model system offers several advantages:

  • Safe handling of otherwise pathogenic targets

  • Controlled genetic background for direct comparisons

  • Established expression and purification protocols

  • Ability to create chimeric constructs to map species-specific functional elements

By systematically characterizing PlsY from diverse bacterial species in the S. carnosus system, researchers can develop a comprehensive understanding of both the fundamental aspects of phospholipid biosynthesis evolution and practical applications for antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.