Recombinant Staphylococcus carnosus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Staphylococcus carnosus

Staphylococcus carnosus is a non-pathogenic bacterium often utilized in the food industry, particularly in raw sausage fermentation, where it contributes to nitrate reduction and flavor formation . S. carnosus is a preferred choice for studying pathogenicity factors from pathogenic staphylococcal species . Researchers have expressed numerous invasion factors and matrix-binding proteins in S. carnosus to study their function . S. carnosus has the ability to secrete large amounts of proteins into the culture supernatant, which allows for easier isolation of proteins in soluble form .

Recombinant Protein Production in Staphylococcus carnosus

S. carnosus is employed as a host for recombinant protein production . Unlike E. coli, S. carnosus can secrete large quantities of proteins into the culture medium, simplifying the isolation process . Proteins can be covalently anchored to the staphylococcal cell wall using a C-terminal recognition sequence, enabling the immobilization of various enzymes on the surface of S. carnosus in an active conformation . This bacterium has been engineered to display heterologous proteins on its cell surface by utilizing the promoter and secretion signals from the lipase gene of Staphylococcus hyicus and the cell wall-spanning and membrane-binding region of protein A from Staphylococcus aureus .

Large-Conductance Mechanosensitive Channel (MscL)

Large-conductance mechanosensitive channels (MscL) are transmembrane proteins that respond to mechanical forces, such as changes in membrane tension . MscL proteins are found in bacteria, and they open in response to membrane stretch, allowing ions to flow across the cell membrane .

Recombinant Staphylococcus carnosus MscL

Recombinant Staphylococcus carnosus Large-conductance mechanosensitive channel (MscL) is produced using an in vitro E. coli expression system .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Specify your desired tag type for preferential development.
Synonyms
mscL; Sca_0989; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Staphylococcus carnosus (strain TM300)
Target Names
mscL
Target Protein Sequence
MFKEFKEFAFKGNVLDLAVAVVMGAAFNKIITSLVTYIIMPLIGLIFGTVDFAKNWSFMG IKYGLFVQSVIDFLIVAFALFLFVKLANTLMRKEEVEEEPEENIVLLTEIRDLLQQQNGT VTNETTNIFTETDDVDNKKF
Uniprot No.

Target Background

Function

A mechanosensitive ion channel that opens in response to membrane tension. It likely plays a role in regulating cellular osmotic pressure.

Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of MscL in Staphylococcus carnosus?

The Staphylococcus carnosus MscL is a large-conductance mechanosensitive channel that forms a homopentamer with each subunit containing two transmembrane domains (TM1 and TM2), a periplasmic loop, and cytoplasmic N and C termini. The protein consists of 140 amino acids and functions as a tension-sensitive safety valve that opens in response to stretch forces in the lipid bilayer .

The channel gates via the bilayer mechanism, which is evoked by hydrophobic mismatch and changes in membrane curvature or transbilayer pressure profile. In its closed state, the channel's pore constriction measures approximately 2-4 Å in diameter, formed by the TM1 domains. Upon hypoosmotic conditions that increase tension in the bacterial membrane, MscL undergoes a dramatic conformational change to form a water-filled, nonselective pore with a diameter of approximately 30 Å .

The primary function of MscL in S. carnosus is osmoregulation, preventing cell lysis during osmotic shock by releasing ions and small molecules to equilibrate pressure differences .

What expression systems are used for recombinant S. carnosus MscL production?

Multiple expression systems have been documented for the production of recombinant S. carnosus MscL, each with specific advantages for different research applications:

Expression SystemAdvantagesApplications
E. coliHigh yield, well-established protocols, cost-effectiveStructural studies, biochemical assays
BaculovirusBetter post-translational modifications, improved foldingFunctional studies, complex analyses

For E. coli-based expression, researchers typically use BL21(DE3) or similar strains with T7 promoter-based vectors. The protein is usually expressed with an N-terminal His-tag to facilitate purification by immobilized metal affinity chromatography (IMAC) . For functional studies requiring proper folding and membrane insertion, researchers should consider carefully optimizing membrane fraction isolation procedures.

Baculovirus expression offers advantages for maintaining protein functionality but requires more complex setup and longer production times. This system may be preferred when studying complex interactions or when conducting functional assays sensitive to protein conformation .

What storage conditions are recommended for recombinant S. carnosus MscL?

Proper storage of recombinant S. carnosus MscL is critical for maintaining protein stability and functionality. Based on manufacturer recommendations and research protocols, the following guidelines should be observed:

  • Lyophilized form:

    • Store at -20°C/-80°C

    • Shelf life: approximately 12 months

    • Keep in sealed containers with desiccant

  • Reconstituted protein:

    • Short-term storage (up to one week): 4°C

    • Long-term storage: -20°C/-80°C in small aliquots

    • Avoid repeated freeze-thaw cycles

    • Add glycerol (final concentration 5-50%, typically 50%) as a cryoprotectant

  • Reconstitution procedure:

    • Briefly centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • For membrane protein studies, consider reconstitution in detergent-containing buffers

    • Typical buffer: Tris/PBS-based buffer, pH 8.0 with 6% Trehalose

For experiments requiring precise control of protein functionality, researchers should verify protein activity after storage using appropriate functional assays before proceeding with critical experiments.

How do mutations in specific residues affect the gating mechanism of MscL?

Mutational studies have revealed critical insights into the gating mechanism of MscL channels. While these studies primarily involved homologs like TbMscL (from Mycobacterium tuberculosis) and EcMscL (from E. coli), the findings can inform research on S. carnosus MscL due to structural and functional conservation among MscL family members.

The L89W mutation in TbMscL (corresponding approximately to M94 in EcMscL) has provided particularly valuable insights. When introduced at the entrance to the transmembrane pockets, this mutation:

  • Stabilizes an expanded and subconducting state of the channel

  • Reduces the threshold required for channel conductance in electrophysiology measurements

  • Destabilizes the closed state by hindering lipid acyl chain penetration into transmembrane pockets

This finding supports the "lipid-moves-first" model of mechanosensation, where:

  • TM pockets are occupied by lipid acyl chains in the closed state

  • Increases in lateral tension cause lipid movement from these pockets to the bulk bilayer

  • This lipid redistribution destabilizes the closed structure and facilitates channel opening

Researchers working with S. carnosus MscL should consider targeting equivalent residues when designing mutation studies to probe gating mechanics specific to this organism.

What spectroscopic techniques can be used to monitor conformational changes in MscL?

Several advanced spectroscopic techniques have proven valuable for monitoring conformational changes in MscL channels during gating. These methodologies provide high-resolution structural information about dynamic channel states:

TechniqueApplicationAdvantagesKey Information
Pulsed Electron-Electron Double Resonance (PELDOR/DEER)Distance measurements between specific residues20-80 Å range, can measure in membrane environmentTracks expansion during gating
Electron Spin Echo Envelope Modulation (ESEEM)Proximity measurements to membraneMaps protein-lipid interactionsDetermines changes in membrane exposure
Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)Measures solvent accessibilityDoes not require protein modificationIdentifies regions undergoing conformational change

Implementation protocol for PELDOR/DEER studies:

  • Introduce cysteine mutations at strategic positions in the MscL sequence

  • Label with MTSSL (methanethiosulfonate spin label)

  • Reconstitute labeled protein into liposomes or nanodiscs

  • Apply mechanical tension (e.g., via osmotic shock or LPC)

  • Measure distances between spin labels at different tension states

These spectroscopic approaches have revealed that conformational changes in MscL involve complex rearrangements of transmembrane domains, with the open state characterized by significant expansion of the pore diameter .

How does LPC activation differ from tension-induced activation in MscL channels?

ParameterTension-Induced ActivationLPC-Induced Activation
MechanismLateral membrane tension transmitted directly to channelAsymmetric insertion into lipid bilayer alters local properties
Structural effectsUniform expansion of channelPossible non-uniform conformational changes
Activation thresholdDepends on membrane composition and protein-lipid interactionsDependent on LPC concentration
Physiological relevanceMimics natural osmotic shock responseMay introduce artificial perturbations

Studies of tension-sensitive MscL mutants and homologs with different tension sensitivities have demonstrated that LPC shifts the free energy of gating by interfering with MscL-membrane coupling, rather than by applying tension directly .

What role does the N-terminal amphipathic helix play in MscL gating?

The amphipathic N-terminal helix of MscL has been identified as a crucial structural element in the gating cycle. Studies indicate this domain plays dual roles:

  • Stabilization of the closed state: The N-terminal amphipathic helix interacts with the membrane interface in the closed conformation, creating an energetic barrier to channel opening that must be overcome by membrane tension.

  • Membrane coupling: This domain functions as a crucial element for coupling channel conformation to membrane dynamics, effectively serving as a tension sensor that communicates mechanical force from the lipid bilayer to the channel gate .

Experimental evidence for this model comes from multiple approaches:

  • Mutation studies altering the amphipathicity of the N-terminus

  • Computational simulations demonstrating conformational changes during gating

  • Functional studies showing altered gating properties when the N-terminus is modified

This mechanism may represent a common principle in mechanosensitive channel function across diverse protein families, suggesting a convergent evolutionary solution to the challenge of mechanical force transduction .

For S. carnosus MscL specifically, research targeting the N-terminal region could provide insights into species-specific adaptations of this mechanosensing mechanism.

How can S. carnosus be used for surface display of heterologous proteins?

Staphylococcus carnosus has proven valuable as a host organism for surface display of heterologous proteins, which could potentially include engineered versions of MscL. This approach offers advantages for structural studies, antibody production, and functional characterization:

A novel expression system for surface display on S. carnosus combines:

  • Promoter and secretion signals from the Staphylococcus hyicus lipase gene

  • Cell wall-spanning and membrane-binding regions from Staphylococcus aureus protein A

  • Reporter proteins (such as serum albumin binding protein) to enhance detection and accessibility

This system has successfully displayed various proteins, including an 80-amino-acid peptide from a malaria blood stage antigen .

Verification methods for successful surface display include:

  • Immunoblotting

  • Immunogold staining

  • Immunofluorescence on intact recombinant cells

  • Fluorescence-activated cell sorting (FACS)

For researchers interested in structural or functional studies of MscL, surface display on S. carnosus could provide a native-like membrane environment while allowing accessibility to external probes or ligands.

What approaches can be used to modulate MscL channel activity?

Researchers have developed several approaches to modulate MscL channel activity, which are valuable for both basic research and potential therapeutic applications:

  • Site-directed mutagenesis:

    • L89W mutation (TbMscL) stabilizes subconducting states

    • Mutations at the pore constriction can alter gating tension thresholds

    • Engineering cysteine residues allows chemical modification of channel properties

  • Lipid environment manipulation:

    • Varying lipid composition affects channel gating characteristics

    • Amphipaths like LPC asymmetrically insert into the membrane to induce channel opening

    • Membrane-active peptides can modify local membrane properties and MscL activity

  • Chemical modification:

    • MTSSL spin labels on introduced cysteine residues can modulate channel function

    • Sulfhydryl-reactive compounds can be used to target specific regions of the channel

    • Charged compounds targeting the pore region can stabilize open or closed states

  • Physical methods:

    • Osmotic shock protocols for activation in cellular systems

    • Application of pressure in patch-clamp experiments

    • Reconstitution in liposomes with controlled membrane tension

Mechanistic understanding derived from these approaches supports the lipid-moves-first model, where tension-induced redistribution of lipids from transmembrane pockets drives conformational changes in the channel protein .

What are the osmotic stress responses involving MscL in S. carnosus?

S. carnosus, like other staphylococci, must adapt to high osmotic conditions frequently encountered in its natural environments. Studies of S. carnosus adaptation to nutrients and osmotic stress in meat models have revealed specific regulatory patterns involving MscL:

When exposed to high NaCl concentrations (0.47 M), S. carnosus exhibits a primary response involving down-regulation of the mscL gene encoding the large conductance mechanosensitive channel. This adaptation helps prevent water efflux and maintains the physical integrity of bacterial cells .

Simultaneously, S. carnosus upregulates genes involved in three different pathways for the synthesis of glycine betaine, a powerful osmoprotectant, as part of its comprehensive osmotic stress response .

This regulatory pattern differs from what is observed in some other bacteria, where MscL is upregulated during osmotic shock to prevent cell lysis . This difference may reflect the specialized adaptation of S. carnosus to high-salt environments.

For researchers studying recombinant S. carnosus MscL, these findings highlight the importance of considering the native regulatory context when designing expression systems and functional studies.

How can researchers determine the clinical importance of MscL studies?

Evaluating the clinical relevance of MscL research requires systematic approaches to determine what constitutes clinically important differences (CIDs) or minimally clinically important differences (MCIDs) in experimental outcomes.

A framework for assessing clinical importance includes:

  • Statistical significance vs. clinical importance:

    • Statistical significance (p < 0.05) indicates a result is unlikely due to chance

    • Clinical importance considers whether the magnitude of effect is meaningful

    • Results can be statistically significant but clinically trivial

  • Systematic determination of clinical importance:

    • Define thresholds for minimally clinically important differences (MCIDs)

    • Consider the relationship between confidence intervals and MCIDs

    • Classify results into four categories of clinical importance:

      • Definite: Lower limit of 95% CI > MCID

      • Probable: MCID between lower limit of 95% CI and point estimate

      • Possible: MCID between point estimate and upper limit of 95% CI

      • Definitely not: MCID > upper limit of 95% CI

For MscL research specifically, clinical importance might be assessed by:

  • Effects on bacterial survival under osmotic stress

  • Impact on antibiotic susceptibility

  • Potential for targeted drug delivery

  • Development of novel antimicrobial approaches

This framework helps researchers articulate the translational relevance of their findings and prioritize research directions with the greatest potential clinical impact.

What biosafety considerations apply to recombinant S. carnosus MscL research?

Research involving recombinant S. carnosus MscL must comply with institutional and national biosafety guidelines, including NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules for US-based researchers.

Key considerations include:

  • Biosafety level requirements:

    • S. carnosus is generally considered Risk Group 1 (minimal risk)

    • Expression in E. coli typically requires BSL-1 containment

    • Higher containment may be required if combined with higher risk elements

  • Institutional oversight:

    • Experiments require Institutional Biosafety Committee (IBC) approval

    • Documentation of risk assessment and containment measures

    • Regular review of protocols and procedures

  • Specific precautions for MscL work:

    • Consider potential for altered membrane permeability in host organisms

    • Evaluate potential for unexpected phenotypes in recombinant organisms

    • Implement appropriate waste disposal procedures

  • Commercial product usage:

    • Commercial recombinant proteins are labeled "Not For Human Consumption"

    • Research-grade materials require appropriate handling and disposal

    • Documentation of acquisition and usage may be required

Researchers should consult their institutional biosafety office for guidance specific to their facility and experimental design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.