Recombinant Staphylococcus carnosus Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Membrane Protein Biogenesis

YidC operates through two pathways:

  1. Sec-independent: Direct insertion of small membrane proteins (e.g., Pf3 coat protein) via a hydrophilic groove .

  2. Sec-dependent: Collaboration with SecYEG for larger substrates (e.g., respiratory complexes) .

Key Mechanisms:

  • Hydrophobic mismatch induction: Thins the lipid bilayer by 7–10 Å, facilitating substrate translocation .

  • Salt-bridge interactions: Positively charged residues (e.g., R72 in E. coli) engage with acidic substrates like Pf3 coat protein .

  • Chaperone activity: Assists in folding Sec-dependent proteins like LacY lactose permease .

Applications in Research and Biotechnology

While recombinant S. carnosus YidC remains understudied, its homologs have significant applications:

Table 2: Potential Applications of Recombinant YidC

ApplicationExampleRelevance to S. carnosus
Membrane protein studiesStructural analysis of substrate insertion mechanisms High (safe, non-pathogenic host)
Antibiotic developmentTargeting YidC in S. aureus with celecoxib derivatives Potential for anti-staphylococcal drug discovery
Synthetic biologyEngineering S. carnosus for metal bioremediation or vaccine delivery Leveraging GRAS status

Critical Insights from YidC Homologs:

  • Essentiality: YidC is indispensable in E. coli and S. aureus, with depletion causing lethality .

  • Antibiotic target: Celecoxib derivatives inhibit S. aureus YidC2, reducing viability under stress .

  • Evolutionary conservation: S. carnosus YidC shares 78% sequence identity with S. aureus YidC, suggesting functional overlap .

Table 3: Comparative Features of YidC Homologs

OrganismGC Content (%)Genome Size (Mbp)Key SubstratesPathogenicity
S. carnosus34.62.56Nitrate reductase, stress-response proteinsNon-pathogenic
S. aureus32.82.80Virulence factors, respiratory complexesPathogenic
E. coli50.84.60LacY, cytochrome o oxidaseOpportunistic

Future Directions and Challenges

Despite advancements, key gaps remain:

  1. Structural data: No crystal structures exist for S. carnosus YidC; homology modeling is needed .

  2. Substrate specificity: Mechanisms differentiating Sec-dependent and independent pathways require elucidation .

  3. Biotechnological optimization: Enhancing recombinant expression in S. carnosus for industrial applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; Sca_1592; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-289
Protein Length
Full Length of Mature Protein
Species
Staphylococcus carnosus (strain TM300)
Target Names
yidC
Target Protein Sequence
CDYSKPENRTGFFYNTFVKNMDNIIHWLGASFNNDYGLAIIVLVLAIRIIVLPFMLSNYK NSHMMREKMIIAKPDMDAVKEKVQRARTQEDKMAANQEMMEVYKKYDMNPMQSMLGCLPM LIQMPIIMGLFFVLKYPSPGGITEHSHFLWFNLAKPDIWITVIAGVLYFLQAYVSTFSMP PEQKQMSYMMMIISPIMIIWVSLSSAAALGLYWSVSAAFLIVQTYIANAYYSKKAKEEVA PMIAAYEKEHGGSGNSKGAKVVSKKNKKKK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 2 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus carnosus and why is it valuable in recombinant protein research?

Staphylococcus carnosus is a non-pathogenic gram-positive bacterium that has demonstrated significant utility as a live vector for surface display of heterologous proteins. Unlike its relative S. xylosus, S. carnosus possesses superior capability to efficiently display whole domains of proteins, including those derived from toxic proteins, on its cell surface . This capacity makes it particularly valuable for protein expression studies and vaccination approaches. The bacterium lacks the extracellular protease activity exhibited by other staphylococcal species like S. xylosus, which helps prevent degradation of displayed proteins once they reach the cell surface . Additionally, the expression system developed for S. carnosus has been shown to be more efficient in translocating heterologous proteins to the cell surface compared to systems developed for other staphylococcal species . These properties collectively make S. carnosus an excellent choice for researchers seeking to express and display complex proteins for immunological studies or protein function investigations.

What is the role of YidC in membrane protein biogenesis?

YidC serves as an essential membrane protein insertase belonging to the Oxa1 superfamily, playing crucial roles in bacterial inner membrane biogenesis by influencing both protein composition and lipid organization . The protein functions through two main mechanisms: it interacts with the Sec translocon to assist in the proper folding of multi-pass membrane proteins, and it operates independently as an insertase and lipid scramblase to augment the insertion of smaller membrane proteins while contributing to bilayer organization . YidC has been demonstrated to enhance the insertion of various substrates including phage coat proteins (M13 and Pf3), ATP synthase subunit c, and other small membrane proteins like SecG . The insertase activity of YidC is particularly important for proteins with transmembrane segments, as evidenced by studies showing differential effects on wild-type SecG versus SecG with the I20E mutation in its first transmembrane segment . This indicates that the hydrophobicity of transmembrane segments represents an important factor in determining YidC substrate specificity and insertion efficiency.

How does YidC interact with YibN and what is the significance of this interaction?

The interaction between YidC and YibN represents a significant discovery with important implications for membrane protein biogenesis. This interaction was initially identified through proximity-dependent biotin labeling (BioID) and subsequently validated using multiple complementary approaches . Affinity purification-mass spectrometry assays conducted on native membranes demonstrated that His-tagged YidC could pull down endogenously expressed YibN with more than 20-fold enrichment over background controls . Reciprocal experiments using His-tagged YibN confirmed this interaction, with endogenous YidC detected at more than 50-fold enrichment over background . The interaction was further validated under native expression conditions using a recombinant strain with chromosomally encoded YibN tagged with a peptide affinity SPA tag, where YidC and YibN emerged as the two most abundant proteins isolated . This interaction appears functionally significant, as YibN enhances the biogenesis of YidC substrates including M13 procoat and Pf3 coat proteins, F1-F0 subunit F0c, and SecG . Additionally, YibN appears to stimulate membrane lipid production and promote inner membrane proliferation, potentially by interfering with YidC lipid scramblase activity .

How can researchers quantify the enhancement of protein insertion by YibN?

Researchers can quantify the enhancement of protein insertion by YibN using both in vivo co-expression systems and in vitro translation/insertion assays. For in vivo co-expression studies, plasmids encoding YidC substrates (such as pMS119 PC-Lep, pMS119 Pf3-Lep, pET20 atpE encoding F0c, or pBAD22 SecG) can be co-transformed with either empty vector pBAD33 (control) or pBAD33 YibN plasmid into an appropriate strain like BL21 (DE3) . Following induction with arabinose and/or IPTG, time-course aliquots can be collected and analyzed by SDS-PAGE and Western Blot to quantify protein production . For in vitro validation, inverted membrane vesicles (INVs) can be prepared from control strains or strains enriched for YibN, then used in translation/insertion assays with purified substrates . The enhancement can be quantified by comparing the insertion efficiency between the control and YibN-enriched vesicles. For example, INVs enriched for YibN supported a 1.5-1.8-fold stimulation of insertion for substrates like Pf3 coat, M13 procoat H5, and F0c compared to control INVs . For membrane proteins like SecG that can exist in multiple orientations, proteinase K digestion can be used to detect and quantify membrane-protected fragments corresponding to different insertion topologies .

What techniques are used to verify protein display on S. carnosus cell surfaces?

The verification of heterologous protein display on S. carnosus cell surfaces employs several complementary techniques. A primary approach involves assessing the binding of antibodies specific to the inserted proteins to intact bacterial cells . In this method, transformed bacteria are incubated with antisera raised against the protein of interest in microfilter plates. After extensive washing and filtering, antibodies that remain bound to the bacterial cells are detected using an appropriate secondary antibody conjugated to an enzyme (such as peroxidase) and a colorimetric substrate like ABTS . The resulting signal intensity directly correlates with the level of surface display. Western blot analysis represents another critical method for verifying protein synthesis, though it does not specifically confirm surface localization . For this approach, bacterial lysates are subjected to SDS-PAGE and Western blot analysis using antibodies reactive against either the inserted protein or a tag incorporated into the expression system . The estimated sizes of the detected proteins should match the predicted molecular weights of the fusion constructs. Additionally, functional assays pertinent to the displayed protein can provide evidence of proper folding and orientation. For proteins with enzymatic activity, activity assays using intact cells can confirm surface accessibility, while for immunogenic proteins, the ability to generate specific antibody responses in immunized animals confirms successful display .

What in vitro assays are recommended for studying YidC-mediated membrane protein insertion?

In vitro assays for studying YidC-mediated membrane protein insertion provide controlled environments for mechanistic investigations. A primary approach involves translation/insertion assays using inverted membrane vesicles (INVs) . For this method, INVs are prepared from strains with varying levels of YidC or YibN expression, then employed in cell-free translation systems with radiolabeled substrate proteins. The efficiency of insertion can be assessed by proteinase K digestion, which degrades non-inserted portions while leaving membrane-protected fragments intact . These protected fragments can be visualized by SDS-PAGE and autoradiography, with quantification allowing direct comparison between different membrane preparations . For multi-pass membrane proteins like SecG that can adopt different topological orientations, this approach can detect distinct membrane-protected fragments corresponding to each orientation, providing insights into topological preferences mediated by YidC or its interacting partners . Researchers can also employ affinity purification approaches to study protein-protein interactions involved in the insertion process. For example, His-tagged YidC can be used to pull down interacting partners from solubilized membranes, with subsequent mass spectrometry analysis identifying the composition of the insertion complex . Stable isotope labeling with amino acids in cell culture (SILAC) techniques provide quantitative assessment of these interactions, distinguishing genuine interactors from background binding .

How can researchers address poor display efficiency of heterologous proteins on S. carnosus?

Poor display efficiency of heterologous proteins on S. carnosus can result from multiple factors requiring systematic troubleshooting approaches. If Western blot analysis detects the fusion protein in bacterial lysates but surface display is minimal, researchers should first examine the signal sequence and anchoring domain functionality . The N-terminal region of the hybrid protein significantly impacts translocation efficiency, with longer propeptides (such as the 209-residue propeptide from lipase used in S. carnosus systems) generally performing better than shorter sequences . Researchers should also consider potential degradation by extracellular proteases, although S. carnosus has been shown to have minimal extracellular protease activity compared to other Staphylococcus species . If protein degradation is suspected, incorporating protease inhibitors during bacterial culture or expression analysis may improve detection. The hydrophobicity and folding properties of the heterologous domain can also impact display efficiency; modifications to improve protein stability or solubility might enhance surface presentation . Expression conditions represent another critical variable, with temperature, induction timing, and induction strength all affecting display efficiency. Lower temperatures and more gradual induction often improve proper folding and display . Finally, researchers should consider the immunological detection method, ensuring that antibodies used for detection recognize surface-accessible epitopes in the displayed protein's native conformation rather than denatured forms only recognizable in Western blots .

What factors influence the efficiency of YidC-YibN mediated membrane insertion?

Multiple factors influence the efficiency of YidC-YibN mediated membrane insertion, with implications for experimental design and interpretation. The hydrophobicity of transmembrane segments represents a primary determinant, as demonstrated by comparative studies between wild-type SecG and its I20E mutant with reduced hydrophobicity in the first transmembrane segment . The I20E mutation significantly reduced the enhancing effect of YibN on SecG insertion, indicating that YibN preferentially assists proteins with more hydrophobic transmembrane domains . The topological complexity of the substrate protein also appears significant, as YibN enhanced the insertion of dual-pass membrane proteins like SecG and F0c but showed no effect on single-pass membrane proteins like YajC and YhcB . The relative expression levels of YidC and YibN likely influence their cooperative function, with optimal ratios potentially varying for different substrate proteins . Membrane lipid composition may also impact insertion efficiency, particularly given YibN's apparent interference with YidC lipid scramblase activity and its stimulation of membrane lipid production . When designing experiments to study YidC-YibN mediated insertion, researchers should therefore consider these variables, implementing controls that account for substrate characteristics, expression levels, and membrane conditions. Quantitative approaches comparing insertion efficiency across multiple substrates and under varying conditions will provide the most comprehensive understanding of factors influencing this process .

How should researchers interpret contradictory results in YidC functionality studies?

Contradictory results in YidC functionality studies often stem from methodological differences that require careful consideration during data interpretation. First, researchers should examine the specific YidC homologs being studied, as different bacterial species express variants with potentially distinct substrate specificities and functional characteristics . The experimental system represents another critical variable, with results from in vivo overexpression potentially differing from in vitro reconstitution studies using purified components . For instance, the enhancing effect of YibN on YidC substrates was observed both in co-expression systems and in vitro translation/insertion assays using inverted membrane vesicles, providing consistent evidence across platforms . Membrane composition differences between experimental systems may significantly impact YidC functionality, particularly given its dual roles in protein insertion and lipid organization . The specific substrate proteins examined also influence outcomes, with factors such as transmembrane domain hydrophobicity critically affecting YidC-dependence . This was demonstrated by the differential effects of YibN on wild-type SecG versus the I20E mutant, where reduced hydrophobicity in the transmembrane segment corresponded with reduced enhancement by YibN . When confronted with apparently contradictory results, researchers should systematically compare the experimental conditions, including expression systems, membrane environments, substrate characteristics, and detection methods. Cross-validation using multiple complementary approaches, as demonstrated in the identification and confirmation of the YidC-YibN interaction, provides the most robust evidence for genuine functional relationships .

What are the most promising applications for recombinant S. carnosus in vaccine development?

The ability of S. carnosus to efficiently display heterologous proteins on its surface presents numerous opportunities for vaccine development against various pathogens. The demonstration that S. carnosus displaying the receptor-binding domain of diphtheria toxin could elicit neutralizing antibodies in mice establishes proof-of-principle for using this system to present immunogenic epitopes from toxins or pathogens . Future research should focus on optimizing the immunogenicity of the recombinant bacteria, as current protocols require multiple injections of high bacterial doses to achieve effective responses . Promising strategies include increasing the proportion of heterologous protein displayed on the bacterial surface and targeting the recombinant bacteria to appropriate immune cells using antibody-mediated approaches . The latter approach seems particularly well-suited to S. carnosus, which has been successfully used for surface display of single-chain variable fragments of immunoglobulins (ScFv) . Comparative studies evaluating different administration routes, adjuvant combinations, and boosting strategies would provide valuable insights for optimizing vaccination protocols. Additionally, exploring the display of multiple antigens simultaneously could enable the development of multivalent vaccines targeting several pathogens or multiple epitopes from a single pathogen. As a non-pathogenic gram-positive bacterium, S. carnosus offers advantages in terms of safety and the natural adjuvant properties of its cell wall components, making it a promising platform for next-generation vaccine development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.