Recombinant Staphylococcus carnosus UPF0060 membrane protein Sca_1835 (Sca_1835)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus carnosus UPF0060 Membrane Protein Sca_1835

Recombinant Staphylococcus carnosus UPF0060 membrane protein Sca_1835, denoted as Sca_1835, is a partial membrane protein derived from the bacterium Staphylococcus carnosus. This protein is part of the UPF0060 family, which is less well-characterized compared to other protein families. The recombinant form of this protein is produced through genetic engineering techniques, where the gene encoding Sca_1835 is inserted into an expression vector and expressed in a suitable host organism, often Escherichia coli or Staphylococcus carnosus itself.

Structure and Function of Sca_1835

The primary structure of Sca_1835 consists of a sequence of amino acids, which dictates its three-dimensional conformation and, consequently, its function. The amino acid sequence of Sca_1835 starts with MIYPILIFILAGLCEIGGGYLIWLWLRASQSPLFGLLGGILLISYGIVATFQVFPTFSRV YAAYGGVFIVMSILWGYVFDKQTPDKYDVLGAIVCIIGVLImLLPDRS . This sequence is crucial for understanding the protein's interactions and potential roles within the cell membrane.

Sequence InformationDescription
Amino Acid SequenceMIYPILIFILAGLCEIGGGYLIWLWLRASQSPLFGLLGGILLISYGIVATFQVFPTFSRV YAAYGGVFIVMSILWGYVFDKQTPDKYDVLGAIVCIIGVLImLLPDRS
Protein LengthPartial sequence, 1-108 amino acids
Gene NameSca_1835

Production and Applications

Recombinant Sca_1835 is produced using advanced biotechnology techniques. The gene encoding this protein is cloned into an expression vector, which is then introduced into a host organism like Staphylococcus carnosus or Escherichia coli. The protein is purified and often used in research settings for studying membrane protein functions or as part of diagnostic assays.

Production DetailsDescription
Host OrganismStaphylococcus carnosus or Escherichia coli
Expression VectorCustom-designed vectors for high-level expression
Purification MethodVarious methods, including affinity chromatography

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
Sca_1835; UPF0060 membrane protein Sca_1835
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Staphylococcus carnosus (strain TM300)
Target Names
Sca_1835
Target Protein Sequence
MIYPILIFILAGLCEIGGGYLIWLWLRASQSPLFGLLGGILLISYGIVATFQVFPTFSRV YAAYGGVFIVMSILWGYVFDKQTPDKYDVLGAIVCIIGVLIMLLPDRS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.