Recombinant Staphylococcus carnosus UPF0060 membrane protein Sca_1835 (Sca_1835)
Description
Introduction to Recombinant Staphylococcus carnosus UPF0060 Membrane Protein Sca_1835
Recombinant Staphylococcus carnosus UPF0060 membrane protein Sca_1835, denoted as Sca_1835, is a partial membrane protein derived from the bacterium Staphylococcus carnosus. This protein is part of the UPF0060 family, which is less well-characterized compared to other protein families. The recombinant form of this protein is produced through genetic engineering techniques, where the gene encoding Sca_1835 is inserted into an expression vector and expressed in a suitable host organism, often Escherichia coli or Staphylococcus carnosus itself.
Structure and Function of Sca_1835
The primary structure of Sca_1835 consists of a sequence of amino acids, which dictates its three-dimensional conformation and, consequently, its function. The amino acid sequence of Sca_1835 starts with MIYPILIFILAGLCEIGGGYLIWLWLRASQSPLFGLLGGILLISYGIVATFQVFPTFSRV YAAYGGVFIVMSILWGYVFDKQTPDKYDVLGAIVCIIGVLImLLPDRS . This sequence is crucial for understanding the protein's interactions and potential roles within the cell membrane.
| Sequence Information | Description |
|---|---|
| Amino Acid Sequence | MIYPILIFILAGLCEIGGGYLIWLWLRASQSPLFGLLGGILLISYGIVATFQVFPTFSRV YAAYGGVFIVMSILWGYVFDKQTPDKYDVLGAIVCIIGVLImLLPDRS |
| Protein Length | Partial sequence, 1-108 amino acids |
| Gene Name | Sca_1835 |
Production and Applications
Recombinant Sca_1835 is produced using advanced biotechnology techniques. The gene encoding this protein is cloned into an expression vector, which is then introduced into a host organism like Staphylococcus carnosus or Escherichia coli. The protein is purified and often used in research settings for studying membrane protein functions or as part of diagnostic assays.
| Production Details | Description |
|---|---|
| Host Organism | Staphylococcus carnosus or Escherichia coli |
| Expression Vector | Custom-designed vectors for high-level expression |
| Purification Method | Various methods, including affinity chromatography |
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Target Background
KEGG: sca:SCA_1835
STRING: 396513.Sca_1835
