Recombinant Staphylococcus carnosus UPF0316 protein Sca_1484 (Sca_1484)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
Sca_1484; UPF0316 protein Sca_1484
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Staphylococcus carnosus (strain TM300)
Target Names
Sca_1484
Target Protein Sequence
MSVISANPWLMLLAIFVINVAYVTCLTVRTILTLKGYRYVAAAVSFIEVLIYIIGLGLVM ANLDKFQNIIAYALGFSVGIIVGMKIEEKLALGYSVVNVTTANYELDLPTQLRNLGYGVT HFPAYGRDGERLVMQILTPRRFELKLMDTIKQIDEKAFVIAYEARTLHGGFWVKGVRSKK LKAYDTDEI
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus carnosus UPF0316 protein Sca_1484?

Staphylococcus carnosus UPF0316 protein Sca_1484 is a full-length protein (1-189 amino acids) derived from the non-pathogenic organism Staphylococcus carnosus. It belongs to the UPF0316 protein family, with its gene located at the Sca_1484 locus in the S. carnosus genome. The protein is notable for being expressed in a bacterial species that has a smaller genome and higher GC content (34.6%) compared to other staphylococcal species . S. carnosus TM300 strain, from which this protein is derived, lacks mobile genetic elements such as plasmids, IS elements, transposons, or STAR elements, contributing to the genetic stability that makes it valuable for research applications .

Why is Staphylococcus carnosus valuable as a model organism for protein studies?

S. carnosus has several characteristics that make it an excellent model organism:

  • Genetic stability: S. carnosus lacks mobile genetic elements (plasmids, IS elements, transposons, or STAR elements), reducing the risk of genetic instability when cloning and expressing proteins .

  • Non-pathogenicity: Unlike S. aureus and other pathogenic staphylococci, S. carnosus is non-pathogenic, making it safer to work with in laboratory settings .

  • Unique resistance mechanisms: S. carnosus possesses resistance to respiratory inhibitors like pyocyanin and cyanide through the cydAB genes encoding a resistant cytochrome bd quinol oxidase, which may be relevant when designing expression systems .

  • Baseline for comparison: S. carnosus lacks many virulence factors found in pathogenic staphylococci, making it an ideal background for studying heterologous proteins. For example, it has been used to study fibronectin-binding proteins, extracellular adherence proteins, and other virulence factors from pathogenic staphylococcal species .

What experimental designs are recommended for studying Sca_1484 function?

When designing experiments to elucidate the function of Sca_1484, researchers should consider the following methodological approaches:

  • Comparative genomics approach: Since Sca_1484 is classified as a UPF0316 protein (uncharacterized protein family), identifying homologs in other bacterial species and comparing their genomic context might provide functional insights.

  • Gene knockout and complementation studies:

    • Design knockout constructs targeting the Sca_1484 gene

    • Create complementation strains expressing the wild-type protein

    • Compare phenotypes between wild-type, knockout, and complemented strains

    • Examine growth under various conditions (different media, stress conditions, etc.)

  • Controlled factorial experimental design: When testing protein function under various conditions, implement a multi-factor experimental approach as described in Chapter 10 of experimental design literature . This would involve:

    • Identifying independent variables (e.g., temperature, pH, substrates)

    • Defining dependent variables (measures of protein activity or cellular response)

    • Controlling for confounding variables

    • Implementing appropriate replication to avoid pseudo-replication

  • Protein-protein interaction studies: Use techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or pull-down assays to identify potential interaction partners.

For all experimental designs, it is essential to conduct proper power analysis to ensure sufficient statistical power to detect effects, should they exist. This involves estimating effect sizes based on preliminary data or literature and calculating the required sample size accordingly .

Purification Methods:

When working with recombinant His-tagged Sca_1484 protein, consider the following purification protocol:

  • Expression system selection: Given that the recombinant protein is His-tagged and expressed in E. coli, optimize expression conditions (IPTG concentration, temperature, duration) .

  • Cell lysis optimization: Since Sca_1484 appears to have transmembrane domains, use appropriate detergents for solubilization (e.g., n-dodecyl β-D-maltoside or Triton X-100).

  • Purification steps:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Size exclusion chromatography for further purification

    • Consider ion exchange chromatography if additional purity is required

  • Storage considerations: Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage, avoiding repeated freeze-thaw cycles .

Functional Characterization Methods:

  • Membrane protein analysis:

    • Investigate membrane localization using subcellular fractionation

    • Determine orientation in the membrane using protease accessibility assays

    • Assess protein-lipid interactions using lipid overlay assays

  • Comparative analysis with S. aureus:

    • Since S. carnosus is often used to study S. aureus proteins, investigate if Sca_1484 has homologs in S. aureus and compare their functions

    • Consider expressing Sca_1484 in S. aureus to determine if it affects pathogenicity

  • Enzymatic activity screening:

    • Test for potential enzymatic activities (oxidoreductase, hydrolase, transferase)

    • Consider potential roles in cyanide resistance pathways, given S. carnosus's resistance to respiratory inhibitors

How should researchers analyze and interpret data from Sca_1484 experiments?

When analyzing experimental data related to Sca_1484, researchers should:

  • Apply appropriate statistical methods:

    • For comparing groups (e.g., wild-type vs. mutant), use t-tests or ANOVA as appropriate

    • For multifactorial experiments, use general linear models or mixed-effects models

    • Consider both statistical significance and effect size when interpreting results

  • Avoid common analytical pitfalls:

    • Be aware of questionable research practices that can lead to non-reproducible research

    • Address multiple testing problems using appropriate corrections

    • Report uncertainties using standard errors and confidence intervals

    • Avoid pseudo-replication by ensuring proper experimental unit definition

  • Data visualization recommendations:

    • Present comparative data in tables rather than lists

    • Use appropriate graphs to visualize protein activity under different conditions

    • Include error bars representing standard errors or confidence intervals

  • Statistical decision-making framework:

Statistical DecisionType I Error (False Positive)Type II Error (False Negative)
Reject H₀ when trueα (typically 0.05)N/A
Fail to reject H₀ when falseN/Aβ (1-β = power)

Statistical power considerations are essential when designing experiments with Sca_1484, particularly because the protein's function is not well-characterized, making effect size estimates challenging .

How can researchers investigate potential interaction partners of Sca_1484?

To identify and characterize potential protein-protein interactions involving Sca_1484:

  • In vivo interaction methods:

    • Bacterial two-hybrid system

    • Protein-fragment complementation assays

    • In vivo crosslinking followed by co-immunoprecipitation

  • In vitro interaction methods:

    • Pull-down assays using His-tagged Sca_1484

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

  • Computational prediction approaches:

    • Sequence-based prediction of interaction sites

    • Structural modeling of potential protein-protein interfaces

    • Genomic context analysis (gene neighborhood, gene fusion, phylogenetic profiling)

  • Validation of interactions:

    • Confirm interactions using multiple independent methods

    • Assess the physiological relevance through mutagenesis of interaction interfaces

    • Examine co-localization in cells using fluorescently tagged proteins

When reporting interaction data, ensure proper statistical analysis of replicates and include appropriate controls to distinguish specific from non-specific interactions.

What considerations should be made when designing gene expression studies involving Sca_1484?

When studying Sca_1484 gene expression:

  • Expression analysis methods:

    • qRT-PCR for targeted expression analysis

    • RNA-Seq for genome-wide expression profiling

    • Reporter gene assays (e.g., using luciferase or GFP fused to the Sca_1484 promoter)

  • Environmental condition considerations:

    • Based on S. carnosus biology, specifically test conditions related to:

      • Oxygen availability (aerobic vs. anaerobic conditions)

      • Presence of respiratory inhibitors like cyanide or pyocyanin

      • Co-culture with Pseudomonas species that produce such inhibitors

      • Various stress conditions (oxidative, nitrosative, osmotic stress)

  • Regulatory element analysis:

    • Identify potential regulatory elements in the Sca_1484 promoter region

    • Consider that S. carnosus regulatory mechanisms may differ from those in E. coli (e.g., the nitrate reductase operon in S. carnosus lacks obvious Fnr and integration host factor recognition sites found in E. coli)

    • Design promoter deletion/mutation studies to identify key regulatory elements

  • Data analysis recommendations:

    • Normalize expression data using appropriate reference genes

    • Use biological and technical replicates to estimate variability

    • Apply appropriate statistical tests for comparing expression levels

    • Consider the magnitude of fold-changes and their biological significance

What are the most promising applications for Sca_1484 in biological research?

Based on the available information, Sca_1484 could be valuable in:

  • Understanding bacterial membrane protein biology, particularly in Staphylococcus species

  • Serving as a model for studying homologous proteins in pathogenic staphylococci

  • Potentially contributing to the understanding of respiratory inhibitor resistance in S. carnosus

  • Acting as a tool for protein engineering applications, leveraging S. carnosus's genetic stability

What are the key methodological considerations for future Sca_1484 research?

Future research on Sca_1484 should consider:

  • Implementing rigorous experimental design with appropriate controls and replication

  • Using open research practices to increase transparency and reproducibility

  • Conducting comprehensive functional analyses rather than focusing on single aspects

  • Integrating multiple approaches (genetic, biochemical, structural) for a complete understanding

  • Applying appropriate statistical methodologies with sufficient power to detect effects of interest

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.