Recombinant Staphylococcus carnosus UPF0344 protein Sca_0577 (Sca_0577)

Shipped with Ice Packs
In Stock

Description

Introduction to Staphylococcus carnosus and Sca_0577 Protein

Staphylococcus carnosus is a Gram-positive bacterium with distinctive characteristics that make it valuable for research and biotechnological applications. The organism has been utilized since the 1950s as an important model organism due to its genetic stability and non-pathogenic nature . Unlike other staphylococcal species, S. carnosus TM300 possesses a relatively small genome with the highest GC content (34.6%) among sequenced staphylococcal species . This genomic stability is attributed to the absence of mobile genetic elements such as plasmids, insertion sequences, transposons, and STAR elements, making it an excellent host for heterologous protein expression .

The UPF0344 protein Sca_0577 is encoded by the Sca_0577 gene in the S. carnosus genome. This protein belongs to the UPF0344 family, a group of uncharacterized proteins found in various bacterial species. The prefix "UPF" (Uncharacterized Protein Family) indicates that the detailed function of this protein remains to be fully elucidated, presenting an opportunity for further research to determine its biological role and significance.

Genetic and Protein Information

The Sca_0577 gene encodes the UPF0344 protein in Staphylococcus carnosus. The protein is identified in the UniProt database with the accession number B9DIS4 . The full-length protein consists of 131 amino acids, spanning positions 1-131 in the native sequence . For research and analytical purposes, recombinant versions of this protein are commonly produced with affinity tags, particularly the N-terminal histidine tag (His-tag), to facilitate purification and detection .

Expression Systems

For research applications, the recombinant Sca_0577 protein is commonly expressed in Escherichia coli expression systems . The use of E. coli provides several advantages for protein production, including:

  1. Rapid growth and high cell density cultures

  2. Well-established genetic manipulation techniques

  3. Efficient expression systems for heterologous proteins

  4. Scalable production capabilities

The recombinant protein is typically fused to an N-terminal histidine tag to facilitate purification using affinity chromatography .

Reconstitution Guidelines

For laboratory use, the lyophilized protein requires proper reconstitution. The recommended procedure includes:

  1. Brief centrifugation of the vial before opening

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol (5-50% final concentration) for long-term storage

  4. Aliquoting for storage at -20°C/-80°C

Predicted Membrane Association

The high content of hydrophobic amino acids in the Sca_0577 sequence suggests that this protein may be associated with cell membranes. Segments rich in hydrophobic residues could form transmembrane domains that anchor the protein in the bacterial cell membrane . This membrane association may be critical for the protein's native function, which remains to be fully characterized.

Comparative Analysis with Related Proteins

The UPF0344 protein family, to which Sca_0577 belongs, includes uncharacterized proteins from various bacterial species. While the specific function of these proteins is not well-established, their conservation across multiple bacterial species suggests an important biological role. Comparative analysis with other members of this protein family could provide additional insights into the structure and function of Sca_0577.

Genomic Stability and Research Applications

S. carnosus has gained recognition as an excellent model organism for studying pathogenicity factors from pathogenic staphylococcal species due to its genomic stability and non-pathogenic nature . Unlike pathogenic staphylococci such as S. aureus and S. epidermidis, S. carnosus lacks many virulence factors and mobile genetic elements, making it more genetically stable and safer to work with in laboratory settings .

The absence of fibronectin-binding proteins and other pathogenicity factors in S. carnosus makes it an ideal host for expressing and studying foreign proteins, as the functions of heterologously expressed proteins can be evaluated without interference from similar native proteins . This characteristic has been exploited to investigate numerous invasion factors and matrix-binding proteins from pathogenic staphylococcal species .

Cell Surface Display Technology

One of the significant applications of S. carnosus in biotechnology is its use in cell surface display systems. Novel expression systems have been developed for the surface display of heterologous proteins on S. carnosus cells . These systems utilize:

  1. Promoter and secretion signals from the lipase gene of Staphylococcus hyicus

  2. Cell wall-spanning and membrane-binding regions from protein A of Staphylococcus aureus

  3. Reporter molecules, such as serum albumin binding proteins, to enhance the accessibility of surface-displayed proteins

This technology enables the display of foreign peptides and proteins on the surface of S. carnosus cells, facilitating various applications including vaccine development, protein engineering, and biosensor development .

Transformation Efficiency

Research has focused on optimizing the transformation efficiency of S. carnosus to levels that enable the creation of cell surface displayed combinatorial protein libraries . This optimization involves investigating various parameters for:

  1. Preparation of electrocompetent cells

  2. Pre-electroporation cell treatment

  3. Electroporation conditions

  4. Post-electroporation recovery procedures

These advancements in transformation efficiency are crucial for expanding the applications of S. carnosus as an expression host for recombinant proteins, including Sca_0577.

Hypothesized Biological Functions

While the specific function of Sca_0577 remains to be fully characterized, its membrane association and conservation suggest potential roles in:

  1. Membrane integrity and stability

  2. Transport of small molecules across the cell membrane

  3. Cell signaling or sensing environmental conditions

  4. Structural support for the cell envelope

Further research is needed to elucidate the precise biological functions of this protein in S. carnosus.

Research and Biotechnological Applications

The recombinant Sca_0577 protein has several potential applications in research and biotechnology:

  1. Structural and Functional Studies: As an uncharacterized protein, Sca_0577 presents opportunities for structural biology investigations to determine its three-dimensional structure and functional mechanisms.

  2. Membrane Protein Research: Given its predicted membrane association, Sca_0577 could serve as a model for studying bacterial membrane proteins.

  3. Antibody Development: Recombinant Sca_0577 could be used to generate antibodies for detection and localization studies.

  4. Protein Engineering: The protein might serve as a scaffold for engineering novel functions or displaying foreign peptides on bacterial surfaces.

  5. Comparative Genomics: Analysis of Sca_0577 and its homologs across different bacterial species could provide insights into bacterial evolution and adaptation.

Comparison with Other Staphylococcal Proteins

S. carnosus proteins, including Sca_0577, differ from those of pathogenic staphylococcal species in several aspects. The genome of S. carnosus TM300 is relatively small and has the highest GC content (34.6%) among sequenced staphylococcal species . This genomic composition likely influences the properties of its encoded proteins.

Unlike pathogenic staphylococci, S. carnosus lacks many virulence factors and surface proteins associated with host cell interaction and immune evasion . This characteristic has made S. carnosus a valuable host for expressing and studying pathogenicity factors from species like S. aureus and S. epidermidis .

The stability of the S. carnosus genome, due to the absence of mobile genetic elements, contributes to the stability of its proteins and their expression . This stability is advantageous for research applications requiring consistent protein expression and function.

Functional Characterization

Systematic approaches to elucidate the function of Sca_0577 could include:

  1. Gene knockout or knockdown studies to observe phenotypic changes

  2. Protein-protein interaction analyses to identify binding partners

  3. Localization studies to determine the precise cellular location of the protein

  4. Comparative genomics to identify conserved domains and potential functions

Applications in Biotechnology

Further exploration of Sca_0577 in biotechnological applications could focus on:

  1. Development of novel cell surface display systems utilizing Sca_0577 as a scaffold

  2. Engineering Sca_0577 for specialized functions in bacterial cells

  3. Utilizing Sca_0577 in biosensor development or diagnostic applications

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sca_0577; UPF0344 protein Sca_0577
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Staphylococcus carnosus (strain TM300)
Target Names
Sca_0577
Target Protein Sequence
MLHLHIFSWVIGIILFIVSYISFTKTGAPKKAYKPLHMTLRLFLVLILFSGVWQVVEEFA TATGSTHMLLTLKMICGIGVVALMEVTLVRKQRGASHKGLFWGTIALIIVTMALGIILPG GPISNMFVITK
Uniprot No.

Target Background

Database Links

KEGG: sca:SCA_0577

Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0344 protein Sca_0577 and what organism does it originate from?

Sca_0577 is a transmembrane protein classified as UPF0344 (Uncharacterized Protein Family 0344) that originates from Staphylococcus carnosus strain TM300. It is a full-length protein consisting of 131 amino acids with the UniProt accession number B9DIS4 . S. carnosus is notably a food-grade coagulase-negative staphylococcal species widely used in food technology and biotechnology, particularly as a starter culture in raw sausage fermentation . The protein has been characterized as a transmembrane protein, which suggests it spans the bacterial cell membrane and likely plays a role in membrane-associated functions, though its specific biological function remains to be fully elucidated.

Why is Staphylococcus carnosus an important expression system for recombinant proteins?

S. carnosus has gained significant importance in molecular biology and protein expression for several compelling reasons:

  • Genomic stability: The sequenced genome of S. carnosus TM300 demonstrates a lack of mobile genetic elements, confirming its stability and suitability for genetic engineering applications .

  • Safety profile: S. carnosus lacks most of the pathogenicity factors found in pathogenic staphylococcal species like S. aureus and S. epidermidis, underscoring its food-grade character and safety for laboratory use .

  • Efficiency in genetic manipulation: Researchers have developed comprehensive methods enabling efficient transformation with DNA, protein expression and secretion, and surface display of recombinant proteins or epitopes .

  • Versatility in protein display: S. carnosus can be used for surface display of heterologous proteins, taking advantage of promoter and secretion signals from other staphylococcal species like S. hyicus, combined with cell wall-spanning and membrane-binding regions from protein A of S. aureus .

  • Homogeneity: Comparison of different S. carnosus isolates by pulsed-field gel electrophoresis has revealed that they form a homogeneous genetic group with minimal variability between strains, making experimental results more consistent and reproducible .

What expression systems are optimal for producing recombinant Sca_0577?

For recombinant production of Sca_0577, the following expression systems have demonstrated efficacy:

  • E. coli expression system: The commercially available recombinant Sca_0577 is produced using an in vitro E. coli expression system . This system offers high protein yields and established purification protocols, making it suitable for initial characterization studies.

  • Surface display in S. carnosus: For functional studies requiring surface display, a specialized expression system has been developed that utilizes:

    • Promoter and secretion signals from the lipase gene of Staphylococcus hyicus

    • Cell wall-spanning and membrane-binding region of protein A from Staphylococcus aureus

    • Optional serum albumin binding protein from streptococcal protein G as a reporter molecule

This system enables efficient surface display of recombinant proteins, which can be verified through immunoblotting, immunogold staining, immunofluorescence, and fluorescence-activated cell sorting (FACS) .

Expression SystemAdvantagesLimitationsBest Applications
E. coli in vitroHigh yield, established protocols, cost-effectiveMay have incorrect folding for membrane proteinsStructural studies, antibody production
S. carnosus surface displayNative-like membrane environment, functional studies possibleMore complex system, potentially lower yieldsFunctional studies, protein-protein interactions, receptor studies

What analytical techniques are most appropriate for studying transmembrane proteins like Sca_0577?

Transmembrane proteins like Sca_0577 present unique challenges for analysis due to their hydrophobic domains and membrane integration. The following analytical techniques are particularly suited for studying such proteins:

  • Immunological detection methods:

    • Immunoblotting (Western blot): For detecting expression and verifying protein size

    • Immunogold staining: For electron microscopy visualization of protein localization

    • Immunofluorescence: For visualizing protein on intact cells

  • Flow cytometry:

    • Fluorescence-activated cell sorting (FACS): For analyzing surface-displayed proteins on gram-positive bacteria, as demonstrated with S. carnosus recombinant proteins

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy: For analyzing secondary structure elements

    • X-ray crystallography or cryo-electron microscopy: For detailed structural analysis (though challenging for membrane proteins)

    • NMR spectroscopy: For studying dynamics and interactions in membrane-mimetic environments

  • Functional assays:

    • Binding assays with potential interaction partners

    • Reporter systems using fusion proteins

    • Membrane localization studies

These techniques can be complementary and should be selected based on the specific research questions being addressed regarding Sca_0577's structure, function, or interactions.

How can I optimize the expression and purification of Sca_0577 for structural studies?

Optimizing the expression and purification of transmembrane proteins like Sca_0577 requires careful consideration of several factors:

Expression optimization:

  • Expression temperature: Lower temperatures (16-25°C) often improve the folding of transmembrane proteins

  • Induction conditions: Optimize inducer concentration and induction timing

  • Host strain selection: Consider specialized E. coli strains for membrane protein expression

  • Detergent screening: Identify detergents that maintain protein stability during extraction

Purification strategy:

  • Utilize the N-terminal 10xHis-tag for immobilized metal affinity chromatography (IMAC)

  • Implement size exclusion chromatography to separate correctly folded protein from aggregates

  • Consider mild detergents during purification to maintain native conformation

  • Monitor protein stability throughout the purification process

Storage recommendations:

  • Store protein at -20°C for short-term storage

  • For extended storage, maintain at -20°C or -80°C

  • Include 50% glycerol in storage buffer to prevent freeze-thaw damage

  • Avoid repeated freezing and thawing; store working aliquots at 4°C for up to one week

For structural studies specifically, consider reconstitution into nanodiscs or lipid bilayers to maintain the native environment of this transmembrane protein, which may be critical for preserving its structural integrity.

What controls should be included when working with recombinant Sca_0577?

Robust experimental design for work with recombinant Sca_0577 should include the following controls:

Negative controls:

  • Empty vector control: Cells transformed with expression vector lacking the Sca_0577 gene

  • Untransformed host cells: To control for background signals and non-specific binding

  • Irrelevant protein control: Another transmembrane protein expressed under identical conditions

  • Secondary antibody-only control: For immunodetection experiments to assess non-specific binding

Positive controls:

  • Known successfully expressed transmembrane protein in the same system

  • Commercial recombinant Sca_0577 as a reference standard

  • For surface display systems, a well-characterized surface protein from S. carnosus

Process controls:

  • Expression time course sampling to determine optimal harvest time

  • Fractionation controls to verify membrane localization

  • Protease protection assays to confirm topology

  • Tag-only construct to assess the impact of the His-tag on protein behavior

These controls help validate experimental findings and rule out artifacts that can arise when working with challenging transmembrane proteins like Sca_0577.

What are the recommended protocols for transforming S. carnosus for surface display of Sca_0577?

Transforming S. carnosus for surface display of recombinant proteins like Sca_0577 requires specialized protocols. Based on established methodologies in the field:

Plasmid construction:

  • Design a fusion construct containing:

    • Promoter and secretion signal from S. hyicus lipase gene

    • The Sca_0577 gene sequence

    • Cell wall-spanning and membrane-binding region from S. aureus protein A

    • Optional: serum albumin binding domain as a reporter

  • Utilize a staphylococcal expression vector like pT182-ST, which contains the promoter and signal peptide from S. carnosus genes

Transformation procedure:

  • Prepare chemically competent S. carnosus cells as described in standard molecular biology protocols

  • Transform S. carnosus with the constructed plasmid using established methods for staphylococcal transformation

  • Select transformants using appropriate antibiotic resistance markers

Verification of surface display:

  • Immunoblotting of cell wall fractions

  • Immunogold staining coupled with electron microscopy

  • Immunofluorescence on intact recombinant S. carnosus cells

  • Fluorescence-activated cell sorting to analyze the presence of surface-displayed proteins

The efficiency of this system has been demonstrated previously with an 80-amino-acid peptide from a malaria blood stage antigen, suggesting it should be applicable to Sca_0577 expression and display .

How can I assess the stability and functionality of recombinant Sca_0577?

Assessing the stability and functionality of recombinant Sca_0577 requires multiple complementary approaches:

Stability assessment:

  • Thermal stability analysis:

    • Differential scanning fluorimetry to determine melting temperature

    • Monitor protein unfolding at different temperatures using intrinsic tryptophan fluorescence

  • Storage stability testing:

    • Aliquot protein and store under different conditions (-80°C, -20°C, 4°C)

    • Analyze samples at regular intervals (1 day, 1 week, 1 month, 3 months)

    • Generally, liquid form has a shelf life of approximately 6 months at -20°C/-80°C, while lyophilized preparations can maintain stability for up to 12 months

  • Detergent compatibility screening:

    • Test protein stability in various detergents using size exclusion chromatography

    • Monitor aggregation state over time using dynamic light scattering

Functionality assessment:

  • Structural integrity:

    • Circular dichroism spectroscopy to confirm secondary structure elements

    • Limited proteolysis to assess proper folding

  • Membrane integration:

    • Liposome reconstitution assays

    • Membrane fractionation of expressing cells

  • Binding partners identification:

    • Pull-down assays using His-tag

    • Surface plasmon resonance with potential interaction partners

    • Cross-linking studies followed by mass spectrometry

The assessment of functionality presents a particular challenge for UPF0344 family proteins like Sca_0577 whose precise biological function remains uncharacterized. In such cases, focusing on structural integrity and developing assays to identify potential binding partners becomes especially important.

What are common issues in expressing transmembrane proteins like Sca_0577 and how can they be addressed?

Transmembrane proteins present unique challenges during recombinant expression. Here are common issues with Sca_0577 expression and their solutions:

IssuePossible CausesSolutions
Low expression yieldToxicity to host cells
Inefficient transcription/translation
Protein degradation
Reduce expression temperature (16-20°C)
Use specialized host strains
Try inducible, tightly controlled promoters
Add protease inhibitors during extraction
Protein aggregationImproper folding
Hydrophobic interactions
Insufficient membrane capacity
Co-express with chaperones
Optimize detergent selection
Try membrane-mimetic environments
Use fusion partners that enhance solubility
Difficult purificationPoor accessibility of His-tag
Non-specific binding
Protein instability during purification
Try different tag positions (N vs C-terminal)
Optimize binding and washing buffers
Include stabilizing agents (glycerol, specific lipids)
Perform purification at 4°C
Loss of native conformationHarsh extraction conditions
Detergent-induced structural changes
Absence of stabilizing lipids
Use milder detergents (DDM, LMNG)
Include native lipids during purification
Consider nanodiscs or liposome reconstitution

For Sca_0577 specifically, considering its full-length is 131 amino acids with multiple transmembrane domains, a gentle extraction protocol with appropriate detergents is crucial. Furthermore, adding 50% glycerol to the storage buffer helps maintain stability, and avoiding repeated freeze-thaw cycles is strongly recommended .

How can I address conflicting experimental results when studying Sca_0577?

When facing conflicting experimental results in Sca_0577 research, a systematic troubleshooting approach is essential:

  • Validate protein identity and integrity:

    • Confirm protein sequence by mass spectrometry

    • Assess protein purity through SDS-PAGE and Western blot

    • Verify tag accessibility with anti-His antibodies or other tag-specific detection methods

  • Evaluate experimental variables:

    • Compare buffer compositions across experiments (pH, salt concentration, detergents)

    • Assess protein concentration effects (aggregation at high concentrations)

    • Consider time-dependent effects (protein stability over the course of experiments)

  • Cross-validate with complementary techniques:

    • If surface display results conflict between methods, compare immunoblotting, immunofluorescence, and FACS data

    • For binding studies, confirm interactions using multiple methods (pull-down, SPR, isothermal titration calorimetry)

  • Control for system-specific artifacts:

    • When comparing E. coli-expressed protein with S. carnosus surface display, consider the impact of different expression systems on protein folding and function

    • Test whether the His-tag or other fusion elements affect protein behavior

  • Implement statistical analysis:

    • Perform sufficient biological and technical replicates

    • Apply appropriate statistical tests to determine significance of differences

    • Consider Bayesian analysis for integrating conflicting datasets

By systematically addressing these aspects, researchers can identify the source of discrepancies and develop a more accurate understanding of Sca_0577's properties and behavior.

What approaches help in determining the biological function of poorly characterized proteins like Sca_0577?

Determining the biological function of poorly characterized proteins like Sca_0577 requires a multi-faceted approach:

  • Bioinformatic analysis:

    • Sequence homology searches against characterized proteins

    • Protein domain prediction and functional annotation

    • Genomic context analysis (neighboring genes often have related functions)

    • Structural prediction and comparison with functionally characterized proteins

  • Gene knockout or silencing studies:

    • Generate S. carnosus TM300 knockout mutants lacking Sca_0577

    • Assess phenotypic changes in growth, stress resistance, or membrane properties

    • Perform transcriptomic or proteomic analysis of knockout strains to identify affected pathways

  • Protein-protein interaction studies:

    • Affinity purification coupled with mass spectrometry to identify binding partners

    • Bacterial two-hybrid screening

    • Cross-linking studies followed by identification of cross-linked partners

  • Localization studies:

    • Immunogold electron microscopy to precisely locate the protein within the membrane

    • Fluorescent protein fusions to track dynamics and localization

    • Membrane fractionation to determine specific membrane domain association

  • Functional assays based on predicted functions:

    • If transmembrane: ion flux or transport assays

    • If involved in cell wall processes: cell wall integrity tests

    • If potentially involved in signaling: phosphorylation or other post-translational modification analysis

  • Heterologous expression in different hosts:

    • Express Sca_0577 in other bacterial species and assess functional complementation

    • Use S. carnosus surface display system to study potential extracellular interactions

This comprehensive approach can provide converging lines of evidence to help elucidate the biological function of this poorly characterized UPF0344 family protein.

What are potential applications for recombinant Sca_0577 in research?

Recombinant Sca_0577, although not fully characterized in terms of its biological function, offers several promising research applications:

  • Model system for membrane protein studies:

    • As a relatively small (131 amino acids) transmembrane protein, Sca_0577 can serve as a model for studying membrane protein expression, purification, and stabilization techniques

    • Its successful expression as a recombinant protein makes it valuable for optimizing protocols for challenging membrane proteins

  • Surface display technology development:

    • Using the established S. carnosus surface display system, Sca_0577 can be employed to refine and extend methodologies for surface display of other proteins

    • The protein can serve as a fusion partner for displaying epitopes or functional domains on bacterial surfaces

  • Staphylococcal membrane biology:

    • Studies of Sca_0577 can yield insights into membrane organization and function in S. carnosus

    • Comparative analysis with homologs in other staphylococcal species may reveal species-specific membrane adaptations

  • Protein-lipid interaction studies:

    • As a transmembrane protein, Sca_0577 can be used to investigate protein-lipid interactions and membrane domain organization

    • These studies could inform broader understanding of bacterial membrane biology

  • Biotechnology applications:

    • If functional characterization reveals useful properties, Sca_0577 could be developed for biotechnological applications leveraging S. carnosus's food-grade status

    • Potential applications in biosensing, biocatalysis, or biocontrol depending on functional properties

What cutting-edge methodologies could advance our understanding of Sca_0577?

Emerging technologies offer exciting opportunities to deepen our understanding of proteins like Sca_0577:

  • Cryo-electron microscopy:

    • Recent advances in cryo-EM have revolutionized membrane protein structural biology

    • Single-particle analysis could potentially reveal the structure of Sca_0577 in a near-native environment

  • Integrative structural biology:

    • Combining multiple experimental techniques (X-ray crystallography, NMR, SAXS, cross-linking mass spectrometry) with computational modeling

    • This approach can yield structural insights even for challenging membrane proteins

  • Native mass spectrometry:

    • Emerging techniques for studying membrane proteins in native-like lipid environments

    • Could reveal oligomeric states and lipid interactions of Sca_0577

  • High-throughput functional screening:

    • CRISPR-based genetic screens to identify genetic interactions

    • Chemical genomics to identify small molecule modulators of Sca_0577 function

  • Advanced microscopy techniques:

    • Super-resolution microscopy for detailed localization studies

    • Single-molecule tracking to study dynamics in living cells

  • Artificial intelligence and machine learning:

    • Structure prediction using AlphaFold or similar AI systems

    • Functional prediction using machine learning algorithms trained on various protein datasets

  • Synthetic biology approaches:

    • Engineering S. carnosus strains with modified Sca_0577 variants

    • Creating minimal systems to test hypothesized functions

These cutting-edge approaches, particularly when used in combination, have the potential to significantly advance our understanding of Sca_0577's structure, function, and biological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.