Recombinant Staphylococcus epidermidis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role of ATP Synthase Subunit a (atpB)

ATP synthase subunit a (encoded by atpB) forms part of the membrane-embedded F0_0 sector, facilitating proton translocation across the bacterial membrane to drive ATP synthesis . In S. epidermidis, this subunit is hypothesized to function similarly to its counterpart in S. aureus, where ATP synthase activity influences biofilm persistence and immune evasion .

3.1. Biofilm and Pathogenicity

ATP synthase subunits in S. epidermidis contribute to biofilm formation, a key virulence factor. Mutations in ATP synthase genes (e.g., atpA) alter host immune responses by modulating bacterial lysis and cytokine production . Subunit a likely plays a role in maintaining proton gradients essential for biofilm matrix stability.

3.2. Antibiotic Resistance

ATP synthase is a target for novel antibiotics like tomatidine (TO), which inhibits subunit c (atpE) . Subunit a’s role in proton transport makes it a potential candidate for similar therapeutic strategies, though no direct inhibitors have been reported.

Technical Challenges and Opportunities

  • Heterologous Expression: Subunit a’s transmembrane domains pose challenges for soluble expression, necessitating optimized vectors and host systems .

  • Functional Assays: ATP hydrolysis and binding studies (e.g., microscale thermophoresis) could validate interactions with protonophores or inhibitors .

Future Directions

  • Structural Characterization: Cryo-EM or crystallography of S. epidermidis ATP synthase could resolve subunit a’s role in proton channel architecture.

  • Therapeutic Development: Targeting subunit a may disrupt energy metabolism in antibiotic-resistant strains, akin to strategies explored in S. aureus .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; SERP1715; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-242
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
atpB
Target Protein Sequence
MDHKSPLVSWNVFGFDIVFNLASVLMVVITAILVFILAIVCTRNLKKRPTGKQNFIEWVF DFVRGIIESNMAWKKGGNFHFLAVTLILFIFVANMLGLPFAIVTHDHTLWWKSPTADATV TLTLSTTMILLTHYYGIKMRGTKAYAAGYFKPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGELLLGLLASLFFEQPAWGWIISIPGLIVWQAFSIFVGTIQAYIFVMLSMVYMSHKVAD GH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase in Staphylococcus epidermidis and what is its fundamental function?

ATP synthase in S. epidermidis, like in other bacteria, is a multi-subunit enzyme complex that produces ATP from ADP in the presence of a proton gradient across the membrane. The complex consists of two main domains: F₁ (containing the catalytic core) and F₀ (containing the membrane proton channel). These domains are linked by a central stalk and a peripheral stalk . The enzyme harnesses the energy of the proton motive force generated by the respiratory chain to synthesize ATP through a rotary mechanism, with proton translocation coupled to ATP synthesis in the catalytic domain .

In staphylococcal species, ATP synthase plays crucial roles beyond energy production, including influencing biofilm formation and host immune responses. Research on S. aureus has shown that ATP synthase is critical for energy production, homeostasis, and maintaining the proton motive force .

What is the nomenclature confusion regarding atpB and ATP synthase subunits?

There is often confusion in the literature regarding bacterial ATP synthase nomenclature. In bacterial systems:

  • The gene atpB typically encodes the a-subunit of the F₀ portion (membrane-embedded sector)

  • The beta subunit of the F₁ portion (catalytic sector) is typically encoded by atpD in bacteria

  • In human/mammalian systems, ATP5F1B or ATP5B refers to the beta subunit

This nomenclature inconsistency between bacterial and eukaryotic systems often creates confusion. The beta subunit has an approximate mass of 52 kDa and is an essential component of the ATP synthase complex . When working with recombinant S. epidermidis ATP synthase components, it's critical to clarify exactly which subunit is being referenced.

What are effective methods for recombinant expression of S. epidermidis ATP synthase subunits?

For recombinant expression of S. epidermidis ATP synthase subunits, researchers can utilize several approaches:

  • Surrogate Host Expression: Similar to the approach used for Embp protein studies, expression in a non-adhesive surrogate host like S. carnosus TM300 can be advantageous for studying protein interactions without interference from other surface proteins . This approach involves:

    • Cloning the target ATP synthase gene into an expression vector with an inducible promoter (e.g., tetracycline-inducible system)

    • Transforming the construct into S. carnosus

    • Inducing expression with an appropriate inducer (e.g., anhydrotetracycline at 200 ng/ml)

    • Confirming expression through Western blotting or other detection methods

  • E. coli Expression Systems: For high-yield production:

    • Optimize codon usage for E. coli

    • Use tags (His6, GST) for simplified purification

    • Express in BL21(DE3) or similar strains optimized for recombinant protein expression

    • Use auto-induction media or IPTG induction protocols

  • Cell-Free Expression Systems: For proteins difficult to express in cellular systems due to toxicity or other issues

What purification strategies are most effective for recombinant S. epidermidis ATP synthase subunits?

Purification of recombinant ATP synthase subunits typically employs a multi-step approach:

  • Affinity Chromatography:

    • For His-tagged constructs: Ni-NTA or TALON resin

    • For GST-tagged constructs: Glutathione Sepharose

  • Ion Exchange Chromatography:

    • Based on the theoretical isoelectric point of the subunit

    • Typically anion exchange (Q Sepharose) for ATP synthase subunits

  • Size Exclusion Chromatography:

    • Final polishing step

    • Separates monomeric from aggregated protein

    • Allows buffer exchange into storage conditions

  • Specialized Techniques for Membrane Proteins:

    • Detergent screening (DDM, LDAO, Triton X-100)

    • Nanodiscs or liposome reconstitution for F₀ subunits

Researchers should validate purified protein using Western blot with specific antibodies , mass spectrometry, and activity assays to ensure both purity and proper folding.

What role does ATP synthase play in S. epidermidis virulence and host-pathogen interactions?

Based on studies in S. aureus and general bacterial pathogenesis principles:

  • Immune Modulation:

    • S. aureus ATP synthase influences myeloid-derived suppressor cell (MDSC) and macrophage (MΦ) activation

    • An S. aureus ΔatpA mutant elicited significantly higher levels of proinflammatory cytokines (IL-12p70, TNF-α, IL-6) from immune cells compared to wild-type

    • This suggests functional ATP synthase may help suppress proinflammatory responses, facilitating bacterial persistence

  • Resistance to Immune Killing:

    • Functional ATP synthase renders S. aureus more resistant to macrophage bactericidal activity

    • Similar mechanisms may operate in S. epidermidis

  • Energy for Virulence Factor Production:

    • ATP synthase provides energy required for production of virulence factors

    • In S. epidermidis, this includes factors required for biofilm formation, which is a major virulence mechanism

Methodological approaches to investigate these aspects include:

  • Co-culture experiments with human immune cells and S. epidermidis wild-type vs. ATP synthase mutants

  • Animal infection models comparing wild-type and mutant strains

  • Analysis of virulence factor production in ATP synthase mutants

How can structural studies of S. epidermidis ATP synthase inform antimicrobial development?

Structural studies of S. epidermidis ATP synthase can provide valuable insights for antimicrobial development:

  • Target-Based Drug Design:

    • High-resolution structures (obtained through X-ray crystallography or cryo-EM) can identify unique features of bacterial ATP synthase compared to human counterparts

    • Molecular docking studies can identify potential binding sites for inhibitors

    • Structure-activity relationship studies can guide optimization of lead compounds

  • Investigation of Species-Specific Features:

    • Comparison of S. epidermidis ATP synthase with other bacterial species can identify unique structural features

    • These unique features could be targeted for species-selective inhibition

  • Methodological Approaches:

    • Recombinant expression and purification of individual subunits or subcomplexes

    • Protein crystallization trials with various conditions and additives

    • Cryo-electron microscopy of the intact complex

    • NMR studies of smaller subunits or domains

    • Computational modeling and molecular dynamics simulations

What experimental approaches can elucidate the role of ATP synthase in S. epidermidis antibiotic resistance?

Several experimental approaches can investigate the relationship between ATP synthase function and antibiotic resistance in S. epidermidis:

What techniques are most effective for studying S. epidermidis ATP synthase in the context of biofilm infections?

For studying ATP synthase in biofilm contexts, researchers should consider:

  • In Vitro Biofilm Models:

    • Static biofilm assays in microtiter plates

    • Flow cell systems to mimic dynamic conditions

    • Confocal microscopy with fluorescent probes for ATP or membrane potential

  • Ex Vivo Models:

    • Biofilm formation on medical device materials

    • Human tissue explant models

  • In Vivo Models:

    • Prosthetic joint infection (PJI) mouse models, similar to those used for S. aureus studies

    • Catheter-associated infection models

    • Implant-associated infection models

  • Advanced Analytical Techniques:

    • Single-cell analysis of ATP levels within biofilms

    • Spatial transcriptomics to map gene expression across biofilm regions

    • Live-cell imaging with ATP biosensors

  • Functional Measurements:

    • Real-time measurements of ATP production within biofilms

    • Membrane potential assessments in biofilm bacteria

What antibodies and detection methods are available for S. epidermidis ATP synthase research?

Researchers have several options for detection of S. epidermidis ATP synthase components:

  • Commercial Antibodies:

    • Anti-ATPB antibodies like EPR11991 (ab170948) may cross-react with bacterial ATP synthase beta subunits due to sequence conservation

    • These antibodies are suitable for applications including Western blot, immunoprecipitation, and flow cytometry

  • Custom Antibody Development:

    • Production of polyclonal antibodies against recombinant S. epidermidis ATP synthase subunits

    • Identification of species-specific epitopes for targeted antibody development

  • Alternative Detection Methods:

    • FLAG, His, or other epitope tags for recombinant protein detection

    • Mass spectrometry-based approaches for unbiased detection

    • Activity-based probes that bind to functional ATP synthase

What expression systems are optimal for functional studies of recombinant S. epidermidis ATP synthase?

For functional studies, researchers should consider:

  • Homologous Expression Systems:

    • Expression in S. epidermidis backgrounds with deleted native ATP synthase genes

    • Inducible expression systems using anhydrotetracycline (AHT) similar to those used for Embp studies

  • Heterologous Expression in Related Species:

    • S. carnosus as a surrogate host (as used for Embp studies)

    • Expression in S. aureus strains

  • Membrane Protein Expression Systems:

    • Specialized E. coli strains designed for membrane protein expression

    • Cell-free expression systems with supplied lipids or detergents

  • Reconstitution Approaches:

    • Expression and purification of individual subunits followed by reconstitution

    • Liposome reconstitution for functional studies of intact complex

What are the current challenges in studying S. epidermidis ATP synthase and how might they be overcome?

Researchers face several challenges:

  • Membrane Protein Complexity:

    • ATP synthase is a large, multi-subunit membrane protein complex

    • Solution: Use detergent screening, nanodiscs, or native membrane vesicles for functional studies

  • Limited S. epidermidis-Specific Research:

    • Most detailed ATP synthase studies are from model organisms or S. aureus

    • Solution: Develop S. epidermidis-specific genetic tools and antibodies

  • Biofilm Heterogeneity:

    • Bacteria in different regions of biofilms may have varying ATP synthase expression/activity

    • Solution: Single-cell approaches and spatial transcriptomics/proteomics

  • Physiological Relevance:

    • In vitro conditions may not reflect in vivo ATP synthase function

    • Solution: Develop more physiologically relevant models incorporating host factors

How might understanding S. epidermidis ATP synthase advance treatment of biofilm-associated infections?

Understanding S. epidermidis ATP synthase could advance treatment strategies through:

  • Novel Antimicrobial Targets:

    • Identifying unique features of bacterial ATP synthase for selective inhibition

    • Developing compounds that target ATP synthase function specifically in biofilm contexts

  • Biofilm Disruption Strategies:

    • Similar to how Esp (a serine protease from S. epidermidis) can disassemble S. aureus biofilms , targeting ATP-dependent processes might disrupt established biofilms

    • Combination therapies coupling ATP synthase inhibitors with conventional antibiotics

  • Immune Response Modulation:

    • Based on S. aureus findings, ATP synthase appears to influence host immune responses

    • Potential for immunomodulatory approaches that enhance bacterial clearance

  • Diagnostic Applications:

    • Development of ATP synthase-targeted imaging probes for biofilm detection

    • Biomarkers based on ATP synthase components or activity

How do variations in ATP synthase affect S. epidermidis strain virulence and fitness?

This question could be addressed through:

  • Strain Collection Analysis:

    • Sequence analysis of ATP synthase genes across clinical and commensal isolates

    • Correlation of sequence variations with virulence traits or clinical outcomes

  • Isogenic Mutant Construction:

    • Generation of point mutations in key ATP synthase residues

    • Assessment of resulting changes in fitness, virulence, and biofilm formation

  • Competition Assays:

    • In vitro and in vivo competition between wild-type and ATP synthase mutants

    • Determination of fitness costs associated with ATP synthase variations

  • Transcriptional Analysis:

    • Compare transcriptional responses to environmental stresses between strains

    • Identify compensatory mechanisms in strains with ATP synthase variations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.