Recombinant Staphylococcus epidermidis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
atpF; SERP1713; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
atpF
Target Protein Sequence
MTATANTFILGAGVEWGTTFVTLVTFVILIILLKKFAWGPLKEVMDKRERDINKDIDDAE QAKINAQKLEEENRKTLKETQDEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSE INSQKERAISDINNQVSELSVLIASKVLRKEISEQDQKELVEKYLKEAGDK
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk that connects F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural and functional role of ATP synthase subunit b (atpF) in S. epidermidis?

Subunit b (atpF) in S. epidermidis ATP synthase serves as a critical component of the peripheral stalk (stator), connecting the membrane-embedded F₀ domain with the catalytic F₁ domain. Unlike the central γ, δ, and ε subunits that form the rotor, subunit b is part of the stationary peripheral stalk that prevents the α₃β₃ hexamer from rotating with the central stalk during catalysis.

In bacterial ATP synthases, including S. epidermidis, the peripheral stalk typically consists of two b subunits (b₂) . The N-terminal region of subunit b anchors in the membrane, while its elongated C-terminal domain extends along the F₁ domain, interacting with the δ subunit (homologous to OSCP in mitochondrial ATP synthase). This arrangement allows the peripheral stalk to function as a stator against which the rotor components turn during ATP synthesis or hydrolysis .

Structure of bacterial ATP synthase showing subunit b location:

ComponentSubunitsFunction in ATP Synthase
F₁ domainα₃β₃γδεCatalytic domain where ATP synthesis/hydrolysis occurs
F₀ domainab₂c₈-15Membrane-embedded proton channel
Rotorγδεc-ringRotates during catalysis
Statorab₂Prevents F₁ rotation during catalysis
Peripheral stalkb₂Connects F₁ to F₀ and acts as stator

How does ATP synthase function differ between S. epidermidis and other bacterial species?

S. epidermidis ATP synthase functions similarly to other bacterial ATP synthases but with some notable differences:

  • Unique peripheral components: S. epidermidis ATP synthase contains two previously unidentified ORFs (serp1129 and serp1130) not found in well-characterized systems like B. subtilis . These components may influence ATP synthase assembly or regulation specifically in S. epidermidis.

  • Transcriptional regulation: Unlike some bacteria, S. epidermidis ATP synthase gene expression (including the atpF gene) is regulated by σᴮ-dependent promoters. This indicates that environmental stresses affecting σᴮ activity would directly impact ATP synthase expression .

  • Role in biofilm formation: S. epidermidis ATP synthase plays a significant role in biofilm development and virulence, particularly in medical device-associated infections. Studies with S. aureus (a close relative) show that ATP synthase mutations affect biofilm architecture and immune response .

Comparative table of ATP synthase features across bacterial species:

FeatureS. epidermidisB. subtilisE. coli
c-ring stoichiometryUnknownc₁₀c₈-c₁₀
Unique componentsserp1129, serp1130NoneNone
Transcriptional regulationThree promoters, one σᴮ-dependentSeven distinct promotersMultiple promoters
Role in virulenceCritical for biofilm formationLimited role in virulenceLimited role in virulence

What methodologies are available for studying ATP synthase activity in recombinant systems?

Several methodologies can be employed to study ATP synthase activity when working with recombinant subunits:

  • ATP/GTP binding assays: Nucleotide binding can be assessed using labeled ATP/GTP analogs. Competition assays with unlabeled nucleotides help determine binding specificity and affinity .

  • ATP synthesis activity measurement: ATP synthesis can be measured using methods similar to those described for S. aureus, involving lysis of bacterial cells in MOPS buffer and monitoring ATP production enzymatically .

  • Rotation assays: Single-molecule techniques can visualize subunit rotation during ATP synthesis/hydrolysis using fluorescently labeled subunits .

  • Cryo-EM analysis: Structural analysis of assembled ATP synthase complexes with recombinant components can reveal conformational states and functional mechanisms .

  • Fluorescence Resonance Energy Transfer (FRET): This technique can measure distances between labeled subunits to analyze conformational changes during ATP synthesis .

How can recombinant S. epidermidis atpF be optimally expressed and purified for structural studies?

Optimal expression and purification of recombinant S. epidermidis atpF requires careful consideration of several factors:

Expression Systems and Optimization:

  • E. coli-based expression: BL21(DE3) strains are commonly used for membrane protein expression. For atpF, consider using C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression.

  • Expression vector selection: Use vectors with tightly controlled promoters (T7 or tac) and appropriate fusion tags (His₆, MBP, or SUMO) to enhance solubility.

  • Expression conditions: Lower induction temperatures (16-25°C) often improve proper folding of membrane proteins like atpF. IPTG concentrations between 0.1-0.5 mM generally yield better results than higher concentrations.

  • Co-expression strategies: Co-expressing atpF with its interacting partner subunits can improve stability and solubility.

Purification Protocol:

  • Membrane fraction isolation: Lyse cells using either sonication or French press in buffer containing 50 mM MOPS, pH 7.0, 5 mM MgCl₂, 1 mM EDTA, and protease inhibitors.

  • Detergent solubilization: Solubilize membranes with mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% (w/v) or digitonin at 1-2% (w/v).

  • Affinity chromatography: Purify using Ni-NTA (for His-tagged protein) followed by size exclusion chromatography to remove aggregates.

  • Quality assessment: Use dynamic light scattering and thermal shift assays to evaluate protein stability in different buffer conditions.

Optimal Buffer Conditions for S. epidermidis atpF:

Purification StepBuffer CompositionCritical Parameters
Cell lysis50 mM MOPS pH 7.0, 5 mM MgCl₂, 1 mM EDTA, protease inhibitorsComplete lysis without overheating
Membrane solubilizationAbove buffer + 1% DDM or digitonin, 300 mM NaCl1-2 hour incubation at 4°C
Affinity chromatography50 mM Tris pH 8.0, 300 mM NaCl, 0.05% DDM, 20-250 mM imidazoleGradual imidazole elution
Size exclusion20 mM Tris pH 8.0, 150 mM NaCl, 0.03% DDM, 5% glycerolFlow rate ≤0.5 ml/min
StorageAbove buffer with 10% glycerolFlash-freeze in liquid nitrogen

What experimental approaches can determine the interaction between atpF and other ATP synthase subunits?

Several complementary approaches can be used to characterize the interactions between recombinant atpF and other ATP synthase subunits:

1. Co-immunoprecipitation (Co-IP):

  • Express atpF with an affinity tag (His, FLAG, or HA)

  • Use antibodies against the tag to pull down atpF and associated subunits

  • Analyze interacting partners by mass spectrometry or western blotting

  • This approach can identify novel interaction partners beyond known ATP synthase components

2. Surface Plasmon Resonance (SPR):

  • Immobilize purified atpF on a sensor chip

  • Flow solutions containing potential binding partners over the chip

  • Measure binding kinetics (kon and koff rates) and calculate binding affinities (KD)

  • Particularly useful for quantitative analysis of atpF interactions with the δ subunit

3. Chemical Crosslinking Coupled with Mass Spectrometry:

  • Use bifunctional crosslinkers (e.g., DSS, BS3, or EDC) to covalently link interacting proteins

  • Digest crosslinked complexes and analyze by LC-MS/MS

  • Identify crosslinked peptides to map interaction interfaces

  • This technique can provide detailed spatial information about protein-protein contacts

4. Fluorescence Resonance Energy Transfer (FRET):

  • Label atpF and potential binding partners with donor and acceptor fluorophores

  • Monitor energy transfer when proteins interact, indicating proximity

  • This method works in solution or can be applied to membrane reconstituted systems

5. Bacterial Two-Hybrid System:

  • Fuse atpF and potential interacting partners to T18 and T25 fragments of adenylate cyclase

  • Co-transform into reporter bacterial strain

  • Measure β-galactosidase activity as indicator of protein interaction

  • This system is particularly useful for membrane proteins like atpF

TechniqueAdvantagesLimitationsBest for Studying
Co-IPWorks with endogenous proteins, identifies complexesCannot determine direct interactionsIdentifying novel partners
SPRProvides binding kinetics, label-freeRequires purified proteinsMeasuring binding affinities
Crosslinking-MSMaps interaction interfaces, works in native complexesComplex data analysisDetermining contact points
FRETWorks in living cells, provides spatial informationRequires fluorescent labelingMeasuring distances between subunits
Bacterial Two-HybridTests specific pairs, works with membrane proteinsArtificial systemConfirming direct interactions

What methodological approaches can be used to study the role of atpF in antimicrobial resistance?

Given that ATP synthase is an emerging antimicrobial target, investigating atpF's role in antimicrobial resistance requires specialized methodologies:

1. Gene Knockout and Complementation Studies:

  • Generate atpF deletion mutants in S. epidermidis using CRISPR-Cas9 or allelic replacement

  • Complement with wild-type or modified atpF genes for functional validation

  • Assess changes in minimum inhibitory concentrations (MICs) for various antimicrobials

  • Analyze growth curves in the presence of subinhibitory antimicrobial concentrations

2. Site-Directed Mutagenesis of Potential Drug-Binding Residues:

  • Identify conserved residues in atpF that may interact with antimicrobials

  • Create point mutations at these sites

  • Express recombinant mutant proteins and assess drug binding using thermostability assays

  • Test mutant strains for altered antimicrobial susceptibility profiles

3. Molecular Docking and Simulation:

  • Generate structural models of S. epidermidis atpF based on homologous proteins

  • Perform in silico docking of antimicrobial compounds to identify potential binding sites

  • Validate predictions through experimental binding studies with recombinant protein

  • Use molecular dynamics simulations to understand drug-protein interactions

4. ATP Synthase Activity Assays in the Presence of Antimicrobials:

  • Measure ATP synthesis/hydrolysis activities using methods similar to those described for S. aureus

  • Test activity in the presence of various antimicrobial compounds

  • Determine IC50 values for ATP synthase inhibition

  • Compare wild-type and mutant enzymes to identify resistance mechanisms

5. Biofilm Susceptibility Testing:

  • Form S. epidermidis biofilms with wild-type or atpF-modified strains

  • Test antimicrobial penetration and efficacy against biofilms

  • Use confocal microscopy with live/dead staining to visualize antimicrobial effects

  • Quantify biofilm biomass and viability after antimicrobial treatment

Antimicrobial Compounds Known to Target ATP Synthase:

Compound ClassExamplesBinding Site/MechanismPotential for Resistance via atpF
DiarylquinolinesTMC207 (Bedaquiline)c-subunitIndirect - conformational changes in atpF may affect c-subunit binding
OligomycinsOligomycin AF₀ sector at the a/c interfaceMutations in atpF may alter the alignment of a/c subunits
Peptide inhibitorsVarious antimicrobial peptidesMultiple binding sites including α/β interfaceDirect - peptides may interact with exposed portions of atpF
PolyphenolsResveratrol, QuercetinF₁ sectorMutations in atpF may affect binding by altering F₁ conformation
EfrapeptinsEfrapeptin CInterface between γ and α/β subunitsIndirect - atpF mutations may alter γ positioning

What are the challenges in developing atpF-targeted antimicrobials against S. epidermidis biofilm infections?

Developing antimicrobials targeting S. epidermidis atpF presents several unique challenges:

Structural and Functional Challenges:

  • Selectivity issues: The structure of ATP synthase is highly conserved across species, making it difficult to develop compounds that selectively target bacterial ATP synthase without affecting human mitochondrial ATP synthase.

  • Accessibility barriers: As part of the peripheral stalk, much of atpF is shielded by other ATP synthase components, limiting direct access for drug binding. Furthermore, in biofilms, the extracellular matrix creates an additional physical barrier for drug penetration .

  • Functional redundancy: S. epidermidis can use alternative metabolic pathways for energy generation under stress, potentially reducing the efficacy of atpF-targeted therapeutics .

  • Conformational dynamics: The peripheral stalk undergoes conformational changes during ATP synthesis/hydrolysis, making it challenging to design inhibitors that bind effectively across all conformational states .

Biofilm-Specific Challenges:

  • Altered metabolic state: Bacteria in biofilms often exist in a slow-growing or dormant state with reduced ATP synthase activity, potentially limiting the effectiveness of inhibitors targeting this enzyme .

  • Penetration barriers: The biofilm matrix severely limits antimicrobial penetration. Any atpF-targeted drug must overcome this barrier to reach bacteria embedded within the biofilm .

  • Physiological heterogeneity: Cells within biofilms exhibit variable metabolic states, creating subpopulations that may be more or less susceptible to ATP synthase inhibitors .

Promising Research Directions:

ApproachMethodologyPotential AdvantagesDevelopment Challenges
Peptide inhibitorsDesign peptides that bind to exposed regions of atpFCan be highly specific, potential for biofilm penetrationSusceptibility to proteases, delivery challenges
Small molecule inhibitorsHigh-throughput screening against recombinant atpFBetter pharmacokinetics, potential for optimizationSelectivity concerns, identifying effective binding sites
Structural vaccinologyIdentify immunogenic epitopes of atpF for vaccine developmentCould prevent biofilm formation, immune-mediated clearanceAntigenic variation, immune evasion mechanisms
Combination therapiesPair atpF inhibitors with matrix-degrading enzymesEnhanced biofilm penetration and efficacyComplex development and regulatory pathway
Nanoparticle deliveryEncapsulate atpF inhibitors in biofilm-penetrating nanoparticlesImproved delivery to target siteComplex formulation, manufacturing challenges

How does the expression of recombinant atpF in heterologous systems compare to native expression in S. epidermidis?

Recombinant expression of S. epidermidis atpF in heterologous systems presents several differences compared to native expression that researchers must consider:

Expression Level and Regulation Differences:

In S. epidermidis, ATP synthase genes (including atpF) are expressed from a complex operon with at least three distinct promoters, one of which is σᴮ-dependent . This allows for fine-tuned regulation in response to environmental conditions. In contrast, heterologous expression typically uses strong constitutive or inducible promoters that do not respond to native regulatory signals, resulting in expression levels that may be significantly higher or lower than physiological levels.

Native expression shows maximum levels during exponential growth phase, with tight coordination of all ATP synthase subunits . Heterologous expression often lacks this temporal control and coordination with other subunits.

Post-translational Modifications and Folding:

The native S. epidermidis cellular environment provides chaperones and folding machinery specifically adapted for proper atpF folding. Heterologous systems may lack these specific factors, potentially affecting protein folding and stability.

While bacterial proteins generally lack extensive post-translational modifications, any specific modifications that may occur in S. epidermidis would likely be absent in heterologous systems, potentially affecting function or interactions.

Membrane Insertion and Complex Assembly:

As a membrane protein, atpF requires proper insertion into the membrane by the Sec translocon. Different organisms may have variations in their membrane insertion machinery that affect the efficiency and orientation of insertion.

The lipid composition of S. epidermidis membranes differs from that of common expression hosts like E. coli, potentially affecting the stability and function of membrane-inserted atpF.

Comparison of Expression Systems for S. epidermidis atpF:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliWell-established protocols, high yield potential, ease of genetic manipulationDifferent membrane composition, potential toxicity, inclusion body formationUse C41/C43 strains, lower induction temperature (16-20°C), co-express with chaperones
Bacillus subtilisCloser phylogenetic relationship to S. epidermidis, similar Gram-positive cell envelopeLower yields than E. coli, fewer expression toolsOptimize codon usage, use controlled expression systems like SURE or LIKE
Cell-free systemsAvoids toxicity issues, allows direct incorporation into liposomesExpensive, limited scale, potential folding issuesSupplement with chaperones and S. epidermidis lipid extracts
S. aureusVery similar physiology to S. epidermidisPathogenicity concerns, fewer expression toolsUse attenuated strains, controlled expression vectors
Native expression in S. epidermidisAuthentic environment, proper assemblyLower yields, greater handling precautionsUse controlled overexpression, optimize growth conditions

Functional Evaluation Methods:

To determine whether recombinant atpF functions similarly to native protein, several approaches can be employed:

  • Complementation studies: Express recombinant atpF in S. epidermidis atpF mutants and assess restoration of function.

  • Structural analysis: Compare the structural properties of native and recombinant atpF using circular dichroism, thermal stability assays, and limited proteolysis.

  • Interaction studies: Assess the ability of recombinant atpF to interact with other ATP synthase subunits through co-immunoprecipitation or in vitro binding assays.

  • Reconstitution experiments: Incorporate purified recombinant atpF into liposomes with other ATP synthase components and measure ATP synthesis/hydrolysis activities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.