Recombinant Staphylococcus epidermidis Cardiolipin synthase 1 (cls1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cls1; SE_0997; Cardiolipin synthase 1; CL synthase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-490
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 12228)
Target Names
cls1
Target Protein Sequence
MNFGFLGTILTILLVVGFITNVVLAFVIIFLERDRRTASSTWAWLFVLFVLPVIGFILYL FLGRTVSKKKMEKNNGDELNAFEDLVQDQIDSFDKHNYGYINDQVIKHRDLIRMLLMKQD AFLTENNKIDLFTDGHKLYEKVLEDIYNAQDYIHLEYYTFELDGLGKRILDALETKLKEG LEVKLLYDDVGSKKVRLSKFKHFRALGGEVEAFFPSKVPLINFRMNNRNHRKIIIIDGQI GYVGGFNVGDDYLGLGKLGYWRDTHTRVQGEGIDALQLRFILDWNSQSHRPQFKFDQKYF PKKIGDKGNAAIQIASSGPAFDLHQIEYGYTKMIMSAKKSIYLQSPYFIPDQSYINALKM AANSGVEVNLMIPCKPDHPFVYWATFSNAADLLDSGVNIYTYQNGFIHSKILMIDDEISS IGSANMDFRSFELNFEVNAFIYDEDIAKQLRQAFEKDIEQSKLLTKEVYDKRPLSIKFKE GLAKLISPIL
Uniprot No.

Target Background

Function
This recombinant *Staphylococcus epidermidis* Cardiolipin synthase 1 (Cls1) catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, producing cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
Database Links

KEGG: sep:SE0997

STRING: 176280.SE0997

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin synthase 1 and what is its role in Staphylococcus epidermidis?

Cardiolipin synthase 1 (cls1) is a membrane-bound enzyme (EC 2.7.8.-) that catalyzes the synthesis of cardiolipin, a key phospholipid component in bacterial membranes. In S. epidermidis, cls1 is encoded by the cls1 gene (locus SERP0885) . The protein contains 490 amino acids and features multiple transmembrane domains consistent with its membrane-associated function. Cardiolipin plays critical roles in membrane organization, particularly at cell division sites and in energy-transducing membranes. In pathogenic contexts, cardiolipin can influence bacterial persistence, adaptation to environmental stresses, and potentially contribute to antibiotic resistance mechanisms by altering membrane permeability and function.

How does cls1 expression vary across different S. epidermidis clonal lineages?

While the search results don't provide specific data on cls1 expression across lineages, we can infer relationships based on S. epidermidis population structure. S. epidermidis isolates demonstrate significant clonal diversity, with sequence type 2 (ST2) being prominently associated with infections worldwide . ST2 strains typically demonstrate enhanced biofilm formation and carry multiple antimicrobial resistance genes. Expression of membrane-associated proteins like cls1 may vary between lineages adapted to different environments (commensal versus infection-associated). The global ST2 lineage has a distinct expression profile that supports persistence in nutrient-limited, iron-restricted environments typical of infection sites, which may implicate differential regulation of membrane composition enzymes like cls1 .

What is the structural organization of the cls1 protein?

The cls1 protein from S. epidermidis strain ATCC 35984/RP62A (UniProt: Q5HPM5) consists of 490 amino acids with a complex structural organization . The amino acid sequence (MNFGFLGTILTILLVVGFITNVVLAFVIIFLERDRRTASSTWAWLFVLFVLPVIGFILYLFLGRTVSKKKMEKNNGELHAFEDFVQDQIDSFDKHNYGYINDQVIKHRDIIRYLLMKQDAFLTENNKIDLFTDGHKLYEKVLEDIYNAQDYIHLEYYTFELDGLGKRILDALETKLKEGLEVKLLYDDVGSKKVRLSKFKHFRALGGEVEAFFPSKVPLINFRMNNRNHRKIIIIDGQIGYIGGFNVGDDYLGLGKLGYWRDTHTRVQGEVIDALQLRFILDWNSQSHRPQFKFDQKYFPKKIGDKGNAAIQIASSGPAFDLHQIEYGYTKMIMSAKKSIYLQSPYFIPDQSYINALKMAAMSGVEVNLMIPCKPDHPFVYWATFSNAADLLDSGVNIYTYQNGFIHSKILMIDDEISSIGSANMDFRSFELNFEVNAFIYDEDIAKQLRQAFEKDIEQSKLLTKKVYDKRPLSIKFKEGLAKLISPIL) reveals multiple hydrophobic transmembrane domains, particularly at the N-terminus, consistent with its membrane-anchoring function . The catalytic domain contains conserved motifs required for phospholipid synthesis activity, and the protein likely adopts a topology where catalytic regions are positioned to facilitate phospholipid headgroup modification within the membrane environment.

What are the optimal storage and handling conditions for recombinant cls1 protein?

For optimal stability and activity retention, recombinant S. epidermidis cls1 should be stored at -20°C in a Tris-based buffer containing 50% glycerol . For extended storage periods, -80°C is recommended. Repeated freeze-thaw cycles should be strictly avoided as they can significantly degrade protein quality and enzymatic activity. Working aliquots can be maintained at 4°C for up to one week, but should not be stored longer at this temperature . When designing experiments, researchers should prepare appropriately sized single-use aliquots during initial receipt to minimize freeze-thaw cycles.

The protein preparation should maintain a consistent temperature during handling, and buffer exchange procedures (if required) should be performed rapidly at 4°C. Given the membrane-associated nature of cls1, addition of mild detergents or lipid components might be necessary for maintaining proper folding and activity when diluting from the glycerol-containing storage buffer.

How should experimental designs account for cls1 variation in clinical versus commensal S. epidermidis isolates?

When designing experiments to study cls1 across S. epidermidis populations, researchers must account for genetic and phenotypic heterogeneity. Based on population structure analysis of S. epidermidis, we recommend the following experimental design considerations:

  • Include diverse genetic backgrounds: Incorporate isolates from multiple sequence types, particularly comparing ST2 (infection-associated) with other commensal-associated lineages .

  • Control for growth conditions: Different S. epidermidis lineages show varying growth capabilities in nutrient-rich versus restricted media. Infection-associated isolates demonstrate enhanced growth in iron-free, nutrient-poor conditions (AUC 1.8-2.0-fold higher), which may affect cls1 expression and function .

  • Account for within-host diversity: S. epidermidis demonstrates significant intra-clonal diversity within a single infection. Design experiments that sample multiple colonies from the same patient to capture this heterogeneity .

  • Block for environmental factors: Follow fundamental experimental design principles using randomization and appropriate blocking to control for environmental variables that might influence cls1 expression or activity .

This table summarizes recommended experimental groups for cls1 comparative studies:

GroupGenetic BackgroundSourceGrowth MediaReplicates
1ST2Clinical isolatesNutrient-rich (TSB)≥3 biological
2ST2Clinical isolatesNutrient-poor (RPMI)≥3 biological
3ST2Commensal isolatesNutrient-rich (TSB)≥3 biological
4ST2Commensal isolatesNutrient-poor (RPMI)≥3 biological
5Non-ST2Clinical isolatesNutrient-rich (TSB)≥3 biological
6Non-ST2Clinical isolatesNutrient-poor (RPMI)≥3 biological
7Non-ST2Commensal isolatesNutrient-rich (TSB)≥3 biological
8Non-ST2Commensal isolatesNutrient-poor (RPMI)≥3 biological

What assay methods are most appropriate for measuring cls1 enzyme activity in vitro?

For measuring cls1 enzyme activity, researchers should consider these methodological approaches:

  • Radioactive substrate incorporation assay: Using 14C or 3H-labeled phospholipid substrates to measure cardiolipin formation rate. This highly sensitive method allows quantification of enzyme kinetics by tracking labeled substrate conversion to cardiolipin.

  • HPLC-MS/MS analysis: This non-radioactive approach measures reaction products with high specificity. Enzyme reactions are stopped at defined timepoints, lipids extracted, and cardiolipin species quantified using chromatographic separation coupled with mass spectrometry.

  • Fluorescent substrate analogs: Modified phospholipid substrates containing fluorescent moieties can enable real-time monitoring of enzymatic activity through fluorescence intensity or FRET-based detection.

For membrane protein enzymes like cls1, reconstitution conditions are critical. Consider incorporating the following in your experimental design:

  • Testing multiple detergent types and concentrations

  • Including phospholipid components that mimic bacterial membranes

  • Varying pH, temperature, and ionic strength to determine optimal conditions

  • Adding potential cofactors (divalent cations, particularly Mg2+)

When comparing activity across different S. epidermidis isolates, standardization of protein content and membrane fraction preparation is essential for valid comparisons.

How does cls1 contribute to S. epidermidis adaptation during infection establishment?

Cardiolipin synthase 1 likely plays an important role in S. epidermidis adaptation during infection establishment, particularly in implant-associated infections. S. epidermidis isolates from infections show phenotypic adaptations including enhanced growth in nutrient-restricted conditions and reduced production of pro-inflammatory molecules compared to commensal isolates . As a membrane phospholipid biosynthesis enzyme, cls1 may contribute to these adaptations through:

  • Membrane restructuring: Modifying phospholipid composition to optimize membrane function under infection-specific stresses (host immune factors, nutrient limitation, antibiotic exposure).

  • Biofilm formation support: Infection-associated isolates demonstrate enhanced biofilm formation capabilities. Cardiolipin-rich membrane domains may influence cell-surface properties relevant to adhesion and biofilm development.

  • Metabolic adaptation: Cardiolipin is enriched at sites of energy transduction. Changes in cls1 activity may support metabolic adaptation to the nutrient-restricted environment of infection sites, where infection isolates demonstrate 1.8-2.0 fold better growth compared to commensal isolates .

  • Stress response coordination: Membrane composition affects protein localization and function. Cardiolipin domains may serve as organizational platforms for stress response systems activated during infection.

Research examining cls1 expression and activity across the transition from commensal to infectious state would provide valuable insights into its potential role in adaptation.

What genomic and transcriptomic approaches can reveal cls1 regulation networks in different S. epidermidis genetic backgrounds?

To elucidate cls1 regulation networks across different S. epidermidis genetic backgrounds, researchers should employ multi-omics strategies:

  • Comparative genomics:

    • Whole genome sequencing of diverse S. epidermidis isolates (ST2, ST5, and other lineages)

    • Identification of cls1 promoter variations and potential transcription factor binding sites

    • Analysis of genetic linkage with mobile genetic elements (SCC elements, ACME)

  • Transcriptomics:

    • RNA-Seq under conditions mimicking colonization versus infection

    • Quantification of cls1 expression across growth phases

    • Differential expression analysis comparing nutrient-rich versus restricted conditions

    • Co-expression network analysis to identify genes with similar expression patterns

  • Regulatory network analysis:

    • ChIP-Seq to identify transcription factors binding to the cls1 promoter

    • CRISPR interference screens to identify regulatory factors

    • Investigation of small RNA regulators using specialized RNA-Seq approaches

  • Integration with phenotypic data:

    • Correlation of cls1 expression with membrane phospholipid composition

    • Association of expression levels with antibiotic susceptibility patterns

    • Relationship between cls1 expression and biofilm formation capacity

When designing these studies, researchers should account for S. epidermidis heterogeneity by including multiple isolates from each genetic background and controlling for the significant intra-clonal variation observed in clinical settings .

How does heterogeneity in cls1 sequence and expression contribute to infection persistence?

Intra-clonal diversity appears to be a common feature of S. epidermidis infections, with significant heterogeneity in genotype and phenotype even within a single patient infection . While the search results don't provide specific data on cls1 heterogeneity, we can propose research approaches to investigate this question:

Sequence heterogeneity in cls1 may arise through:

  • Point mutations: Single nucleotide polymorphisms may alter enzyme kinetics or substrate specificity

  • Recombination events: S. epidermidis shows evidence of recombination-driven evolution

  • Mobile genetic element interactions: SCC elements show significant plasticity in infections

Expression heterogeneity may result from:

  • Transcriptional regulation: Different subpopulations may express cls1 at varying levels

  • Stress-responsive expression: Subpopulations experiencing different microenvironments

  • Bistable switching: Similar to the quorum sensing-mediated phenotypes observed in S. aureus

This heterogeneity could contribute to infection persistence through:

  • Functional redundancy: Diverse cls1 variants ensuring phospholipid synthesis under different conditions

  • Antibiotic tolerance: Membrane composition affects drug penetration and activity

  • Metabolic diversification: Supporting population survival in changing host environments

Researchers investigating this question should examine multiple isolates from individual infections, potentially using single-cell approaches to characterize expression heterogeneity and correlate it with phenotypic variation in persistence-related traits.

What are common challenges in working with recombinant cls1 and how can they be addressed?

Researchers working with recombinant S. epidermidis cls1 may encounter several challenges:

  • Protein solubility issues:

    • Challenge: As a membrane protein, cls1 has hydrophobic domains that can cause aggregation.

    • Solution: Use appropriate detergents (DDM, CHAPS, or Triton X-100) during purification and storage. Consider fusion tags that enhance solubility.

  • Low enzymatic activity:

    • Challenge: Loss of activity during purification or storage.

    • Solution: Ensure proper folding by including lipid components during purification. Verify protein integrity by circular dichroism or limited proteolysis before enzymatic assays.

  • Variability between preparations:

    • Challenge: Inconsistent activity between different protein batches.

    • Solution: Standardize expression and purification protocols. Validate each preparation with activity assays before experimental use.

  • Reconstitution challenges:

    • Challenge: Difficult to reconstitute functional enzyme in artificial systems.

    • Solution: Test different membrane mimetics (nanodiscs, liposomes with varying lipid compositions) to identify optimal reconstitution conditions.

  • Expression system limitations:

    • Challenge: Bacterial expression systems may not properly process membrane proteins.

    • Solution: Consider eukaryotic expression systems or cell-free systems specifically designed for membrane proteins.

These challenges can be addressed through careful optimization of expression conditions, purification protocols, and appropriate quality control measures for each batch of recombinant cls1.

How should researchers analyze contradictory data in cls1 functional studies?

When encountering contradictory data in cls1 functional studies, researchers should follow these methodological approaches:

  • Evaluate experimental conditions:

    • Different growth media significantly affect S. epidermidis phenotypes, with infection isolates showing 1.8-2.0 fold better growth in nutrient-restricted media

    • Temperature, pH, and ionic conditions can influence membrane protein activity

    • Detergent choice and concentration may affect enzyme conformation and activity

  • Consider genetic heterogeneity:

    • S. epidermidis shows significant intra-clonal diversity even within single infections

    • Sequence variants may have different functional properties

    • Mobile genetic elements can influence gene expression and protein function

  • Statistical approaches:

    • Use appropriate statistical methods that account for variability

    • Consider blocking designs to control for batch effects

    • Ensure adequate replication to distinguish biological variation from technical noise

  • Reporting recommendations:

    • Document all experimental conditions comprehensively

    • Report negative and contradictory results alongside positive findings

    • Consider preregistration of study designs to reduce bias in analysis

When analyzing contradictory data, remember that S. epidermidis demonstrates remarkable adaptability and phenotypic plasticity, with significant differences between commensal and infection isolates . Contradictions may reflect genuine biological variability rather than experimental error.

What statistical approaches are most appropriate for analyzing cls1 expression across different S. epidermidis populations?

When analyzing cls1 expression across diverse S. epidermidis populations, researchers should employ robust statistical approaches that account for the biological complexity of this species:

  • Mixed-effects models:

    • Account for hierarchical structure (multiple isolates per patient, multiple sequence types)

    • Include both fixed effects (sequence type, clinical vs. commensal source) and random effects (patient, isolation site)

    • Enable detection of population-level patterns while accounting for individual variation

  • Multiple comparison corrections:

    • Given the diversity of S. epidermidis sequence types, many comparisons may be performed

    • Use appropriate methods (Bonferroni, Benjamini-Hochberg) to control false discovery rate

    • Consider a priori contrasts to test specific hypotheses with greater statistical power

  • Replication considerations:

    • Include biological replicates (different isolates of same sequence type)

    • Include technical replicates to estimate measurement error

    • Use power analyses to determine adequate sample sizes for detecting expected effect sizes

  • Multivariate approaches:

    • Principal component analysis or clustering to identify patterns across multiple variables

    • Correlation analyses between cls1 expression and phenotypic traits (biofilm formation, antibiotic resistance)

    • PERMANOVA for testing differences between predefined groups

Following fundamental experimental design principles (replication, randomization, blocking, appropriate unit size) will strengthen the validity of statistical analyses . Given the observed heterogeneity in S. epidermidis populations, larger sample sizes may be required to detect significant patterns in cls1 expression across different lineages.

How might cls1 be targeted in novel anti-biofilm strategies?

Cardiolipin synthase 1 represents a potential target for anti-biofilm strategies against S. epidermidis infections, particularly in medical device-associated contexts. Future research could explore:

  • Small molecule inhibitors:

    • Development of specific cls1 inhibitors that disrupt cardiolipin synthesis

    • Screening natural product libraries for compounds that modulate cls1 activity

    • Structure-based drug design using recombinant cls1 structural information

  • Membrane composition manipulation:

    • Compounds that alter phospholipid ratios to disrupt biofilm formation

    • Adjuvants that enhance antibiotic penetration by modifying membrane properties

    • Surface coatings that interfere with cls1-dependent membrane organization

  • Genetic approaches:

    • CRISPR interference systems targeting cls1 expression

    • Antisense oligonucleotides for specific knockdown in biofilm-forming populations

    • Phage-delivered inhibitory proteins targeting cls1 function

  • Combination therapies:

    • Synergistic effects between cls1 inhibitors and conventional antibiotics

    • Multi-target approaches addressing membrane composition and biofilm matrix

Researchers should note that S. epidermidis demonstrates significant phenotypic plasticity, with infection isolates showing distinct adaptations compared to commensal strains . This adaptability suggests that anti-biofilm strategies may need to target multiple pathways simultaneously for effective biofilm disruption.

What role might cls1 play in S. epidermidis interactions with the host immune system?

Cardiolipin synthase 1 may play significant roles in S. epidermidis-host immune interactions through several mechanisms:

  • Membrane architecture and immune evasion:

    • Cardiolipin-rich domains may influence the exposure or conformation of surface antigens

    • Membrane composition affects resistance to host antimicrobial peptides

    • Cardiolipin domains could influence protein secretion systems involved in immune modulation

  • Inflammatory response modulation:

    • Infection-associated S. epidermidis isolates show reduced hemolytic activity (0.7-fold lower), indicating a low-inflammatory phenotype

    • Membrane phospholipid composition may affect the release of pathogen-associated molecular patterns (PAMPs)

    • Cardiolipin could influence the secretion of phenol-soluble modulins (PSMs), which trigger neutrophil responses

  • Adaptation to immune pressures:

    • cls1 may contribute to membrane remodeling during phagocytosis or exposure to oxidative stress

    • Different sequence types show varied inflammatory potential, with ST5 demonstrating significantly higher hemolytic activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.