Recombinant Staphylococcus epidermidis Cardiolipin synthase 2 (cls2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus epidermidis Cardiolipin Synthase 2 (Cls2)

Recombinant Staphylococcus epidermidis Cardiolipin synthase 2 (Cls2) is an enzyme involved in the synthesis of cardiolipin (CL) . Cardiolipin is a phospholipid found in bacterial membranes, particularly in energy-generating membranes . Cls2, encoded by the cls2 gene, is a key enzyme responsible for cardiolipin production in Staphylococcus epidermidis .

Function and Mechanism of Cls2

Cls2 catalyzes the formation of cardiolipin from two molecules of phosphatidylglycerol (PG) . The enzyme's active site is thought to be similar to that of phospholipase D, with Histidine 217 potentially acting as the active-site nucleophile .

Role of Cardiolipin in Staphylococcus aureus

Cardiolipin is crucial for the full activity of the SaeRS two-component system, which regulates the expression of virulence factors . Deletion of cls2 significantly reduces the transcript levels of Sae target genes like saeQ, coa, and hla . Ectopic expression of cls2 can restore Sae activity in cls2 and cls1 cls2 mutant strains, but not with cls1 .

Cardiolipin is essential for virulence in Staphylococcus aureus . Reduced SaeS kinase activity, resulting from a lack of cardiolipin, decreases staphylococcal virulence in different host environments .

Impact on SaeS Kinase Activity

Cardiolipin-deficient membranes exhibit reduced SaeS kinase activity . The levels of phosphorylated SaeR protein, catalyzed by SaeS in cls2 or cls1 cls2 mutant membranes, are approximately two-fold lower than those in wild-type membranes .

Cls2 and Bacterial Virulence

Strains lacking cls2 are less cytotoxic to human neutrophils and less virulent in mouse models of infection . This suggests that cardiolipin modulates the kinase activity of SaeS and other sensor kinases, aiding the pathogen in adapting to the host environment .

Cls2 in Host Defense Systems

Extracellular group IIA phospholipase A2 (gIIA-PLA2) collaborates with polymorphonuclear leukocytes (PMN) in the degradation of Staphylococcus aureus phospholipids . The concentration of gIIA-PLA2 required for bacterial digestion is reduced tenfold by PMN . The effects of gIIA-PLA2 are more pronounced when present before phagocytosis but are still apparent after S. aureus has been ingested by PMN .

Experimental Data

ExperimentResults
Deletion of cls2Significant decrease in transcript levels of Sae target genes (saeQ, coa, hla)
Ectopic expression of cls2Restoration of Sae activity in cls2 and cls1 cls2 mutant strains, but not with cls1
SaeS kinase activity in cls2 mutantsApproximately two-fold lower levels of phosphorylated SaeR protein compared to wild-type membranes
Virulence studies in cls2 deficient strainsReduced cytotoxicity to human neutrophils and lower virulence in mouse models of infection
gIIA-PLA2 and PMN collaborationDegradation of S. aureus phospholipids during and after phagocytosis by human PMN requires extracellular gIIA-PLA2
HNP1-mediated Sae activationCardiolipin plays a minor role during HNP1-mediated Sae activation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cls2; SERP1695; Cardiolipin synthase 2; CL synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-488
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
cls2
Target Protein Sequence
MALHQSNIIINILLVSAFLLNLVFAFIIIFMERRTANSIWAWLLVLVFLPLVGFILYLLL GRQIQREHIFKLAKEDKVGLEMIVDEQLEALKKQDFSKGNHQIVKFKEMVQMLLYNNAAF LTTDNDLTIYTDGHQKFDDLINDIRHAQSYIHIQYYIIHSDNLGKQLLHELEKKAEEGIE VKMLYDDMGSRDLRKKDLKKFRQKGGHAESFFPSKLPLINLRMNNRNHRKIVVIDGTIGY VGGFNVGDEYIGKSKKFGYWRDTHLRIKGDAVNALQLRFILDWNSQSTRDNLTYESRYFP DVDSGGTIGIQIASSGPDEDWEQIKYGYLKMISSAKESIYIQSPYFIPDQAFLDSIKIAA LGGVDVNIMVPNKRDHPFVYWATLKNVASLLEAGVNVYHYDNGFLHSKTLVIDDEVASVG TANMDNRSFTLNFEVNAFIYDEGVARSLKQAFINDMKLSNKLTSEEYAKRNLLVKFKEGI SQLLSPIL
Uniprot No.

Target Background

Function

Function: Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin synthase 2 in Staphylococcus epidermidis and how does it differ from Cardiolipin synthase 1?

Cardiolipin synthase 2 (cls2) in Staphylococcus epidermidis is an enzyme involved in the biosynthesis of cardiolipin, a key phospholipid component of bacterial membranes. Similar to what has been observed in S. aureus, S. epidermidis likely contains two open reading frames that encode proteins with approximately 30% identity to the principal cardiolipin synthase of Escherichia coli . Cls2 functions in converting phosphatidylglycerol (PG) to cardiolipin (CL), particularly during specific growth phases and stress conditions.

The primary difference between Cls1 and Cls2 lies in their expression patterns, substrate specificity, and functional roles during different growth phases. While both enzymes catalyze the formation of cardiolipin, they may be differentially regulated and serve complementary roles in membrane phospholipid homeostasis.

Why is cardiolipin important in bacterial membranes, specifically in S. epidermidis?

Cardiolipin plays critical roles in bacterial membrane function for S. epidermidis:

  • Membrane stability and integrity maintenance, especially during stress conditions

  • Facilitation of protein-membrane interactions for key cellular processes

  • Contribution to bacterial resistance against host defense mechanisms

  • Support for biofilm formation, a critical virulence factor for S. epidermidis

The conversion of phosphatidylglycerol to cardiolipin is a significant adaptation mechanism during the transition from logarithmic to stationary phase, as observed in related staphylococcal species . This conversion is also induced during phagocytosis by human neutrophils, suggesting cardiolipin's role in survival during host-pathogen interactions.

How does the cardiolipin synthesis pathway integrate with other metabolic processes in S. epidermidis?

The cardiolipin synthesis pathway in S. epidermidis is integrated with several other metabolic processes:

  • Phospholipid biosynthesis pathways, sharing intermediates and regulatory mechanisms

  • Cell division processes, as cardiolipin concentrates at the septum during division

  • Energy metabolism, with cardiolipin supporting the function of respiratory complexes

  • Stress response systems, where membrane composition changes are coordinated with other adaptive responses

This integration reflects the importance of membrane composition adaptations during various growth phases and environmental conditions, similar to what has been documented in S. aureus .

What are the optimal conditions for expressing recombinant S. epidermidis cls2 in E. coli expression systems?

Based on experimental approaches used for similar enzymes, the optimal conditions for expressing recombinant S. epidermidis cls2 in E. coli include:

ParameterOptimal ConditionNotes
E. coli strainBL21(DE3) or derivativesReduced protease activity
Expression vectorpET system with T7 promoterTight regulation, high expression
Induction0.1-0.5 mM IPTGLower concentrations for membrane proteins
Temperature16-25°CReduced temperature improves folding
Duration12-16 hoursExtended for proper membrane integration
Media supplements1% glucose, 10 mM MgCl₂Stabilizes membrane protein expression
OD₆₀₀ at induction0.6-0.8Mid-log phase for optimal expression

Expression can be validated using a CL-deficient E. coli strain, as has been done for S. aureus Cls proteins . This complementation approach confirms not only expression but also functional activity of the recombinant enzyme.

What experimental design would you recommend for analyzing the enzymatic activity of recombinant cls2?

A comprehensive experimental design for analyzing enzymatic activity of recombinant cls2 should include:

  • Enzyme purification protocol:

    • Membrane solubilization using mild detergents (DDM or CHAPS)

    • Nickel affinity chromatography for His-tagged protein

    • Size exclusion chromatography for final purification

  • Activity assay methodology:

    • Substrate preparation: Purified phosphatidylglycerol in appropriate micelles/liposomes

    • Reaction conditions: 30-37°C, pH 7.0-7.5, presence of divalent cations (Mg²⁺)

    • Product detection: Thin-layer chromatography or LC-MS analysis

  • Kinetic characterization:

    • Determination of Km and Vmax for phosphatidylglycerol substrate

    • Analysis of potential allosteric regulation

    • pH and temperature activity profiles

  • Controls:

    • Heat-inactivated enzyme control

    • E. coli cls-deficient strain complementation

    • Comparison with S. epidermidis cls1 activity

This approach allows for complete characterization of enzymatic parameters while ensuring specificity through appropriate controls.

How can I design knockout and complementation studies to investigate cls2 function in S. epidermidis?

For knockout and complementation studies, a robust experimental design would include:

  • Generation of cls2 knockout:

    • Allelic replacement using a temperature-sensitive plasmid system

    • Targeting the cls2 gene with ~1kb homology arms flanking the deletion

    • Selection using appropriate antibiotic markers

    • Confirmation by PCR, sequencing, and Western blot analysis

  • Complementation strategy:

    • Reintroduction of cls2 gene under native or inducible promoter

    • Use of shuttle vectors compatible with S. epidermidis

    • Site-specific integration or stable plasmid maintenance

    • Expression verification by RT-qPCR and Western blot

  • Phenotypic analysis:

    • Membrane phospholipid composition analysis (TLC, LC-MS)

    • Growth curve analysis under various conditions

    • Stress response evaluation (osmotic, pH, antimicrobial peptides)

    • Biofilm formation quantification

  • Experimental design considerations:

    • Include cls1 single knockout and cls1/cls2 double knockout for comprehensive analysis

    • Test multiple growth conditions including stationary phase and neutrophil exposure

    • Employ complementary in vitro and in vivo approaches to validate findings

A Latin square design would be particularly effective for testing multiple variables that might affect cls2 function, allowing for systematic evaluation while controlling for confounding factors .

How does the expression and activity of cls2 change during S. epidermidis biofilm formation and maturation?

The expression and activity of cls2 during biofilm formation and maturation likely follows a dynamic pattern:

Biofilm Stagecls2 ExpressionCardiolipin LevelsFunctional Significance
Initial attachmentModerateBaselineMembrane adaptation to surface contact
Microcolony formationIncreasingElevatedStress response to high cell density
Mature biofilmHighSignificantly elevatedAdaptation to stationary phase physiology
DispersalDecreasingReturning to baselineMembrane remodeling for planktonic state

This temporal regulation would be consistent with the known conversion of phosphatidylglycerol to cardiolipin during transition to stationary phase in staphylococci . The increased cardiolipin content likely contributes to the characteristic properties of biofilm cells, including increased stress tolerance and altered metabolic state.

Research approaches to study this dynamic would include:

  • Temporal transcriptomic and proteomic analysis of biofilm development

  • Fluorescent reporter constructs to visualize cls2 expression in situ

  • Lipidomic analysis of cells extracted from different biofilm regions

  • Comparative analysis between wild-type and cls2 mutants for biofilm architecture and stability

What role does cls2 play in S. epidermidis antimicrobial resistance mechanisms?

The cls2 enzyme likely contributes to antimicrobial resistance in S. epidermidis through several mechanisms:

  • Membrane permeability modulation:

    • Cardiolipin alters membrane fluidity and permeability

    • Creates physical barrier to hydrophilic antimicrobials

    • Reduces accumulation of antimicrobials within the cell

  • Interaction with resistance determinants:

    • Potential stabilization of membrane-associated resistance proteins

    • Co-localization with efflux pump complexes

    • Support for proper functioning of cell wall synthesis machinery

  • Stress response integration:

    • Coordination with other resistance mechanisms during antibiotic exposure

    • Connection to mobile genetic elements carrying resistance genes

    • Potential role in small colony variant formation

  • Biofilm-specific resistance:

    • Contribution to the altered physiological state of biofilm cells

    • Support for extracellular matrix production and stability

    • Role in persister cell formation within biofilms

Research methodology to investigate these mechanisms would include:

  • Minimum inhibitory concentration (MIC) determination for various antimicrobials

  • Time-kill kinetics comparing wild-type and cls2 mutants

  • Membrane integrity assays using fluorescent probes

  • Lipidomic analysis before and after antimicrobial exposure

How do S. epidermidis cls2 polymorphisms across clinical isolates correlate with virulence and hospital adaptation?

Analysis of cls2 polymorphisms across clinical isolates reveals important correlations:

  • Sequence variation patterns:

    • Higher conservation in catalytic domains

    • Variable regions corresponding to membrane interaction domains

    • Potential horizontal gene transfer signatures in some isolates

  • Correlation with clonal complexes:

    • Specific variants enriched in hospital-adapted sequence types like ST2

    • Distinctive polymorphisms in isolates from different clinical settings

    • Association with mobile genetic elements in certain lineages

  • Functional consequences:

    • Altered substrate specificity affecting membrane composition

    • Differential expression patterns during infection

    • Varied responses to host defense mechanisms

  • Clinical implications:

    • Correlation with persistence in hospital environments

    • Association with treatment outcomes and recurrence rates

    • Potential links to specific infection types (catheter-associated, prosthetic joint)

Research approaches should include comparative genomics across diverse clinical isolates, particularly focusing on predominant sequence types like ST2, ST5, and ST210, which show varying prevalence of genetic elements associated with virulence factors .

What are the best approaches for structural characterization of recombinant cls2?

For comprehensive structural characterization of recombinant cls2, a multi-technique approach is recommended:

  • X-ray crystallography protocol:

    • Detergent screening for optimal solubilization (DDM, LMNG, GDN)

    • Lipid cubic phase crystallization for membrane protein

    • Heavy atom derivatives for phase determination

    • Resolution refinement to capture active site details

  • Cryo-EM methodology:

    • Sample preparation with amphipol or nanodisc incorporation

    • Negative staining optimization before cryo-grid preparation

    • Data collection parameters: 300kV microscope, <2Å pixel size

    • Processing workflow: motion correction, CTF estimation, particle picking

  • Complementary techniques:

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Circular dichroism for secondary structure assessment

    • SAXS for solution-state conformation

    • NMR for specific domain analysis

  • Computational modeling:

    • Homology modeling based on related enzymes

    • Molecular dynamics simulations in membrane environment

    • Substrate docking and reaction mechanism prediction

    • Evolutionary analysis of conserved structural features

This integrated approach overcomes the challenges inherent in membrane protein structural biology and provides insights into enzyme mechanism, substrate binding, and potential inhibitor design.

How can I optimize the purification protocol for obtaining large quantities of active recombinant cls2?

An optimized purification protocol for active recombinant cls2 should include:

Purification StageMethodologyCritical ParametersQuality Control
Cell lysisMechanical disruptionBuffer: 50 mM Tris pH 8.0, 300 mM NaClMicroscopic examination
Membrane isolationDifferential centrifugation40,000×g, 1 hourProtein/lipid ratio measurement
SolubilizationDetergent extraction1% DDM, 4°C, overnightClear supernatant after ultracentrifugation
IMAC purificationNi-NTA affinity10-250 mM imidazole gradientSDS-PAGE analysis
Size exclusionSuperdex 200Flow rate: 0.5 ml/minMonodisperse peak profile
Concentration100 kDa cutoff device≤1 mg/ml, 4°CAvoid aggregation
Activity verificationEnzymatic assayStandard conditions>80% of theoretical activity

Key enhancements to this protocol include:

  • Addition of cardiolipin (0.01%) in all buffers to stabilize the enzyme

  • Incorporation of glycerol (10%) to prevent aggregation

  • Use of mild detergents throughout to maintain native-like environment

  • Implementation of completely randomized design (CRD) for optimization experiments

Quality should be assessed by multiple criteria including purity (>95% by SDS-PAGE), homogeneity (dynamic light scattering), and specific activity (compared to native enzyme).

What are the appropriate controls and validation steps for studying cls2-dependent phenotypes in S. epidermidis?

When studying cls2-dependent phenotypes, implement these controls and validation steps:

  • Genetic controls:

    • Clean deletion mutant without antibiotic marker

    • Complemented strain with wild-type cls2

    • Site-directed mutants in catalytic residues

    • cls1 single mutant and cls1/cls2 double mutant

  • Phenotypic validation:

    • Lipidomic analysis confirming cardiolipin reduction

    • Growth curve analysis under multiple conditions

    • Microscopic examination of cell morphology

    • Membrane integrity assessment

  • Expression verification:

    • RT-qPCR for transcript levels

    • Western blot for protein expression

    • Activity assays from membrane preparations

    • Potential polar effects on adjacent genes

  • Experimental design considerations:

    • Latin square design for multi-factor experiments

    • Appropriate biological and technical replicates

    • Blinded analysis of phenotypic outcomes

    • Statistical power analysis for sample size determination

These rigorous controls ensure that observed phenotypes are specifically attributable to cls2 function rather than secondary effects or experimental artifacts.

How should I analyze lipidomic data to quantify changes in membrane composition related to cls2 activity?

A comprehensive approach to analyzing lipidomic data for cls2-related membrane changes includes:

  • Sample preparation standardization:

    • Consistent growth conditions and harvesting points

    • Internal standards addition for each lipid class

    • Efficient extraction protocol optimized for phospholipids

    • Technical and biological replicates design

  • Analytical workflow:

    • LC-MS/MS with reverse phase chromatography

    • Multiple reaction monitoring for targeted quantification

    • High-resolution MS for untargeted discovery

    • Standards-based absolute quantification

  • Data processing pipeline:

    • Peak detection and integration algorithms

    • Normalization strategies (total ion count, biomass, phosphate content)

    • Statistical analysis framework (ANOVA with appropriate blocking design)

    • Multivariate analysis (PCA, OPLS-DA)

  • Interpretation framework:

    • Ratio analysis of cardiolipin to phosphatidylglycerol

    • Acyl chain composition and remodeling assessment

    • Correlation with phenotypic and physiological parameters

    • Mathematical modeling of membrane dynamics

This approach enables detection of subtle changes in membrane composition that may have significant functional consequences for bacterial physiology and virulence.

What bioinformatic approaches are most effective for analyzing cls2 evolution and conservation across staphylococcal species?

Effective bioinformatic approaches for analyzing cls2 evolution include:

  • Sequence collection and curation:

    • Comprehensive database mining (NCBI, UniProt)

    • Hidden Markov Model-based identification

    • Manual curation to confirm annotation accuracy

    • Inclusion of diverse staphylococcal species

  • Comparative sequence analysis:

    • Multiple sequence alignment with MUSCLE or MAFFT

    • Conservation scoring across functional domains

    • Selection pressure analysis (dN/dS ratio calculation)

    • Ancestral sequence reconstruction

  • Phylogenetic analysis:

    • Maximum likelihood and Bayesian inference methods

    • Tree topology testing to evaluate evolutionary hypotheses

    • Reconciliation with species phylogeny

    • Analysis of horizontal gene transfer events

  • Structural bioinformatics:

    • Homology modeling across species variants

    • Molecular dynamics simulations to assess functional differences

    • Binding site conservation analysis

    • Co-evolution networks identification

This comprehensive approach reveals evolutionary patterns and constraints on cls2, potentially identifying species-specific adaptations relevant to pathogenesis and host interaction.

How can I differentiate between cls1 and cls2 contributions to cardiolipin synthesis when designing and interpreting genetic experiments?

To differentiate between cls1 and cls2 contributions, implement these strategies:

  • Genetic manipulation approaches:

    • Creation of single and double knockout mutants

    • Construction of inducible expression systems for each gene

    • Domain swapping to create chimeric proteins

    • Site-directed mutagenesis of specific catalytic residues

  • Expression analysis:

    • Quantitative RT-PCR with gene-specific primers

    • Promoter fusion reporters to monitor regulation

    • Protein tagging for localization and quantification

    • Temporal analysis across growth phases

  • Biochemical differentiation:

    • In vitro activity assays with purified enzymes

    • Substrate specificity profiling

    • Inhibition studies with selective compounds

    • pH and temperature activity profiles

  • Physiological characterization:

    • Stress response phenotyping of mutants

    • Membrane composition analysis under various conditions

    • Biofilm formation and antimicrobial resistance testing

    • Virulence assessment in infection models

  • Experimental design considerations:

    • Randomized complete block design to control for environmental variables

    • Latin square approach for multi-factor experiments

    • Appropriate statistical methods for interaction analysis

These approaches enable dissection of the distinct and overlapping functions of cls1 and cls2, providing insights into their coordinated roles in membrane homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.