Recombinant Staphylococcus epidermidis DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Staphylococcus epidermidis DNA translocase FtsK (ftsK) is a laboratory-produced protein corresponding to the full-length FtsK enzyme from S. epidermidis, a Gram-positive bacterium commonly associated with biofilm formation and opportunistic infections. In bacterial systems, FtsK is a multifunctional DNA motor protein critical for:

  • Chromosome segregation: Directing DNA translocation toward the dif site to resolve chromosome dimers via XerCD-mediated recombination .

  • Cell division coordination: Interacting with divisome proteins to synchronize DNA segregation with septum formation .

  • Membrane remodeling: Facilitating peptidoglycan hydrolase activity and cell envelope dynamics .

While most FtsK studies focus on E. coli or Staphylococcus aureus, the recombinant S. epidermidis variant enables targeted research into species-specific mechanisms of genome segregation and pathogenicity.

Research Applications

Recombinant S. epidermidis FtsK is primarily used in:

ApplicationPurposeRelevance
Biochemical assaysStudying DNA translocation kinetics and KOPS recognition
Structural studiesNMR/EM analysis of DNA-binding domains
Pathogenicity modelsInvestigating chromosome segregation in biofilm-forming pathogens
Enzyme kinetic analysisCharacterizing ATPase activity and XerCD interaction dynamics

Comparative Analysis with Other FtsK Homologs

While S. epidermidis FtsK shares core functions with homologs (e.g., E. coli, D. radiodurans), species-specific differences exist:

FeatureS. epidermidis FtsKE. coli FtsK
Membrane interactionLacks transmembrane domains (unlike E. coli) Contains N-terminal transmembrane domains
KOPS specificityPotential for species-specific motifs (e.g., GGGCAGGG) Recognizes 8-bp GGGNAGGG sequences
Cell division roleLikely regulates Sle1 hydrolase activity (inferred from S. aureus) Directs divisome assembly via FtsA/FtsI

Research Gaps and Future Directions

  • Experimental validation: No published studies confirm the DNA-binding or translocation activity of the recombinant S. epidermidis FtsK.

  • Species-specific mechanisms: The lack of KOPS density in D. radiodurans raises questions about motif recognition in S. epidermidis.

  • Pathogen studies: Further work is needed to link FtsK function to biofilm persistence or antibiotic resistance.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requests. Please indicate your desired format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery timelines may vary depending on the purchasing method and location. For precise delivery estimations, please consult your local distributor.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for a period not exceeding one week.
Reconstitution
To ensure optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a reference for your convenience.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein typically maintains its quality for 12 months when stored at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While we determine the tag type during production, we are open to requests for specific tags. Please inform us of your desired tag, and we will prioritize fulfilling your requirement.
Synonyms
ftsK; SE_0953; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-797
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 12228)
Target Names
ftsK
Target Protein Sequence
MPQAKKRTSTKRKGNKKTNKKKQNETPLRYIFSIIVVILIILGAFQLGIIGRMIDSFFNY LFGMSRYLTYILVLIATIFITYSKQIPRTRRSIGAIVLQLALLFIAQLYFHFSHNITSQR EPVLSFVYKAYEQTHFPNFGGGLIGFYLLKLFIPLISIVGVIIITILLLASSFILLLNLR HRDVTKSLFDNLKSSSNHASESIKQKREQNKIKKEEKAQLKEAKIERKKQKKSRQNNNVI KDVSDFPEISQSDDIPIYGHNEQEDKRPNTANQRQKRVLDNEQFQQSLPSTKNQSINNNQ PSTTAENNQQQSQAEGSISEAGEEANIEYTVPPLSLLKQPTKQKTTSKAEVQRKGQVLES TLKNFGVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPG RSAVGIEVPNDKISLVTLKEVLEDKFPSKYKLEVGIGRDISGDPISIQLNEMPHLLVAGS TGSGKSVCINGIITSILLNTKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKASQA LEKIVSEMERRYDLFQHSSTRNIEGYNQYIRKQNEELDEKQPELPYIVVIVDELADLMMV AGKEVENAIQRITQMARAAGIHLIVATQRPSVDVITGIIKNNIPSRIAFAVSSQTDSRTI IGAGGAEKLLGKGDMLYVGNGESTTTRIQGAFLSDQEVQDVVNYVVEQQKANYVKEMEPD APVDKSEMKSEDALYDEAYLFVIEKQKASTSLLQRQFRIGYNRASRLMDDLERNQVIGPQ KGSKPRQILVDLENDEV
Uniprot No.

Target Background

Function
FtsK is an essential cell division protein that plays a crucial role in coordinating cell division and chromosome segregation. The N-terminus is involved in assembling the cell-division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the dif recombination site, which is located within the replication terminus region. FtsK is essential for activating the Xer recombinase, thereby facilitating chromosome unlinking through recombination.
Database Links

KEGG: sep:SE0953

STRING: 176280.SE0953

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of FtsK in Staphylococcus epidermidis?

FtsK in S. epidermidis, similar to other bacterial species, functions as a DNA translocase involved in chromosome segregation during cell division. It helps coordinate bacterial chromosome replication/segregation with cell division, ensuring proper chromosome partitioning to daughter cells. The protein consists of multiple domains with distinct functions: an N-terminal membrane-spanning domain anchoring it to the divisome, a linker region, and a C-terminal motor domain that translocates DNA. In S. epidermidis, which is a commensal bacteria ubiquitous on human skin, FtsK plays a crucial role in maintaining genomic integrity during cell division, particularly important in clinical contexts where S. epidermidis forms biofilms on indwelling medical devices .

How does S. epidermidis FtsK compare structurally to FtsK from other bacterial species?

S. epidermidis FtsK shares fundamental structural characteristics with FtsK proteins from other bacterial species, particularly the well-studied E. coli FtsK. The protein consists of α and β subdomains that form a hexameric ring structure through which double-stranded DNA passes. The α subdomains connect to the β motor domains which contain nucleotide-binding pockets that power DNA translocation. High-resolution structural studies of FtsK from E. coli reveal a hexameric ring with subunits in various conformational states during the ATP hydrolysis cycle . In both species, basic residues from two loops (with key residues K657, R661 in loop I and R632, K643 in loop II in E. coli) interact with the phosphodiester backbone of DNA, forming spiral staircases that follow the DNA helix . While specific amino acid differences exist between species, the mechanistic principles of DNA translocation appear to be conserved.

What is known about the interaction between FtsK and other divisome proteins in S. epidermidis?

In S. epidermidis, FtsK interacts with other divisome proteins to coordinate chromosome segregation with cell division. Though specific S. epidermidis interactions are less well-characterized than in model organisms, studies in related Staphylococcus species provide insights. In S. aureus, FtsK interacts with the trigger factor (TF) chaperone, which affects the cellular localization of important cell wall hydrolases like Sle1 . This interaction likely occurs via the N-terminal and/or linker domain of FtsK. The proper localization of these proteins is critical for normal cell separation following division, as demonstrated by the formation of connected cells (tetrads) when FtsK is mutated . These interactions highlight FtsK's role beyond DNA translocation, suggesting it serves as a checkpoint coordinator linking chromosome segregation with septum splitting and cell separation in Staphylococcus species.

What molecular mechanisms drive the ATP-dependent DNA translocation activity of S. epidermidis FtsK?

S. epidermidis FtsK translocation occurs through coordinated ATP hydrolysis within its hexameric motor domain, creating conformational changes that propel DNA through the central pore. Based on detailed structural studies of FtsK homologs, we understand that the hexameric ring exists in an asymmetric state during active translocation, with subunits in different conformational states corresponding to different steps in the ATP hydrolysis cycle .

The DNA translocation mechanism involves:

  • ATP binding to subunits positioned at the bottom of the "spiral staircase" arrangement

  • Sequential ATP hydrolysis that propagates around the hexameric ring

  • Conformational changes that alter DNA-binding loop positions, creating a "hand-over-hand" motion

  • Direct interaction with DNA through basic residues (particularly K657, R661, R632, and K643) that contact the phosphodiester backbone

  • A complete cycle of ATP hydrolysis around the ring translocates approximately 12 base pairs of DNA

The process creates a slight deformation of DNA as it passes through the channel, with the minor groove widening by up to 25% from canonical B-form DNA . This mechanism allows FtsK to translocate DNA at remarkably high speeds, helping to clear chromosomal DNA from the division septum before cell separation.

How does the directionality of S. epidermidis FtsK translocation get established on the chromosome?

Directionality of FtsK translocation is established through recognition of specific DNA sequence elements and their orientation on the chromosome. In well-studied systems like E. coli, this involves short, polarized DNA sequences called KOPS (FtsK-orienting polar sequences) that are recognized by the γ-domain of FtsK through interaction with DNA-binding proteins like FtsK Orienting Protein (FtsK γ-XerD). Though specific S. epidermidis KOPS-equivalent sequences remain less characterized, the fundamental mechanism likely applies.

These directional sequences are oriented in opposite directions on each chromosome arm, pointing toward the terminus region where chromosome dimer resolution occurs. When FtsK encounters these sequences in the non-permissive orientation, its translocation efficiency decreases or reverses direction, ensuring movement toward the terminus. This directional bias is crucial for the protein's biological function in clearing chromosomal DNA from the division site and promoting proper chromosome dimer resolution through recruitment of site-specific recombinases to the dif site in the terminus region .

What is the relationship between FtsK activity and chromosome dimer resolution in S. epidermidis?

In S. epidermidis, as in other bacteria, FtsK likely plays a critical role in chromosome dimer resolution (CDR) - a process essential when homologous recombination between sister chromosomes creates chromosome dimers that must be resolved before cell division. Based on established models from E. coli, FtsK translocates DNA to position the dif recombination sites properly and then activates the XerCD recombinases to perform site-specific recombination .

The process involves:

  • FtsK translocation toward the terminus region where dif sites are located

  • Positioning and alignment of dif sites

  • Direct activation of XerD recombinase through interaction with FtsK's γ-domain

  • XerCD-mediated recombination at aligned dif sites converting dimeric chromosomes to monomers

Modeling suggests this is topologically complex, with at least 2m recombination events needed to convert a right-handed 2m-catenane (linked chromosomes) to unlinked chromosomes . The FtsK-dependent XerCD-dif recombination system ensures faithful chromosome segregation by resolving dimeric chromosomes and unlinking catenated chromosomes before cell division is completed.

What are the optimal conditions for expressing and purifying recombinant S. epidermidis FtsK?

Expressing and purifying functional recombinant S. epidermidis FtsK requires careful optimization of multiple parameters, given its large size and membrane association. Based on successful approaches with homologous proteins, the following protocol is recommended:

Expression System and Conditions:

  • Expression Vector: pET-based with a C-terminal His6 or His10 tag

  • Host: E. coli BL21(DE3) or derivatives (C43/C41 for membrane proteins)

  • Induction: 0.2-0.5 mM IPTG at OD600 = 0.6-0.8

  • Temperature: 16-18°C post-induction for 16-18 hours

  • Media supplementation: 5-10 mM glucose to suppress basal expression

Purification Strategy:

  • Lysis in buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 1 mM DTT, and protease inhibitors

  • Initial capture on Ni-NTA resin with 20-40 mM imidazole to reduce non-specific binding

  • Elution with 250-300 mM imidazole

  • Size exclusion chromatography using Superose 6 column in buffer containing 20 mM HEPES pH 7.5, 150 mM NaCl, 10% glycerol, 1 mM DTT

Critical Considerations:

  • Express only the C-terminal motor domain (FtsKαβγ) for solubility if the full-length protein proves difficult

  • Include ATP or non-hydrolyzable analogs (1-2 mM) in buffers to stabilize the hexameric form

  • Maintain protein concentration below 5 mg/ml to prevent aggregation

  • Flash-freeze aliquots in liquid nitrogen and store at -80°C for long-term stability

This approach typically yields 0.5-2 mg of purified protein per liter of culture, with >90% purity suitable for biochemical and structural studies.

How can I design experiments to assess the DNA translocation activity of purified S. epidermidis FtsK in vitro?

Several complementary approaches can be used to assess the DNA translocation activity of purified S. epidermidis FtsK:

1. Triplex Displacement Assay:

  • Principle: FtsK displaces a radiolabeled or fluorescently labeled triplex-forming oligonucleotide from dsDNA during translocation

  • Setup: Linear DNA substrate with a bound triplex-forming oligonucleotide

  • Detection: Time-dependent decrease in triplex signal measured by gel electrophoresis or real-time fluorescence

  • Quantification: Calculate translocation rates from displacement kinetics

2. Single-Molecule Magnetic Tweezers:

  • Principle: Direct observation of DNA translocation by individual FtsK hexamers

  • Setup: One end of DNA tethered to a surface, the other to a magnetic bead

  • Detection: Changes in DNA extension as FtsK translocates and introduces supercoiling

  • Quantification: Measure translocation rate and processivity at the single-molecule level

3. ATP Hydrolysis Coupled Assay:

  • Principle: FtsK DNA translocation is coupled to ATP hydrolysis

  • Setup: NADH-coupled assay measuring ADP production

  • Detection: Decrease in NADH absorbance at 340 nm

  • Quantification: Determine ATP consumption rate per unit time

Experimental Conditions Table:

ParameterOptimal RangeNotes
Temperature25-37°C37°C recommended for physiological relevance
ATP concentration1-5 mMSaturation typically reached at ~2 mM
DNA substrate5-10 kb linear dsDNAPreferably containing S. epidermidis KOPS-like sequences
Protein concentration10-50 nM (hexamer)Higher concentrations may lead to aggregation
Buffer25 mM Tris-HCl pH 7.5, 10 mM MgCl2, 150 mM NaClIncluding 0.1 mg/ml BSA improves stability
Cations5-10 mM MgCl2Essential for ATP hydrolysis

These approaches provide complementary data on FtsK's translocation activity, with single-molecule techniques offering insights into heterogeneity and rare events that bulk assays might miss.

What methods are most effective for studying FtsK-DNA interactions in S. epidermidis?

Multiple complementary approaches can be employed to study FtsK-DNA interactions in S. epidermidis:

1. Electrophoretic Mobility Shift Assays (EMSA):

  • Useful for determining basic binding parameters (Kd values)

  • Best performed with FtsK protein lacking ATPase activity (Walker A mutant)

  • Short (30-50 bp) DNA fragments with various sequences to identify preference

  • Include competitor DNA to assess specificity

2. DNase I Footprinting:

  • Identifies specific DNA regions protected by FtsK binding

  • Requires radiolabeled DNA fragments and purified FtsK

  • Can reveal extended protection patterns characteristic of hexameric proteins

  • Compare footprints with different nucleotides (ATP vs. ADP vs. non-hydrolyzable analogs)

3. Cryo-Electron Microscopy:

  • Provides structural insights into FtsK-DNA complexes

  • Based on successful approaches with E. coli FtsK, prepare complexes with:

    • FtsK concentration: 0.5-1 μM (hexamer)

    • DNA: 45-60 bp duplex (preferably containing KOPS-like sequences)

    • Nucleotide: 1-2 mM ATPγS or ADP

  • Vitrify samples on glow-discharged grids using automated plunging systems

4. Chromatin Immunoprecipitation Sequencing (ChIP-seq):

  • For in vivo identification of FtsK binding sites across the S. epidermidis genome

  • Requires antibodies against S. epidermidis FtsK or expression of epitope-tagged FtsK

  • Can reveal chromosome-wide distribution of binding sites and potential consensus sequences

  • Best performed with synchronized cell populations at different division stages

5. Förster Resonance Energy Transfer (FRET):

  • For examining conformational changes during FtsK-DNA interaction

  • Label DNA with appropriate donor/acceptor pairs

  • Alternatively, introduce labeling sites in FtsK through site-directed mutagenesis

  • Can provide real-time insights into translocation and DNA deformation

These methods together provide a comprehensive view of FtsK-DNA interactions, from basic binding parameters to structural details and genome-wide binding patterns.

How can I distinguish between specific and non-specific DNA binding by S. epidermidis FtsK in biochemical assays?

Distinguishing between specific and non-specific DNA binding by S. epidermidis FtsK requires systematic analysis using multiple complementary approaches:

Competitive Binding Analysis:

  • Perform EMSAs with labeled target DNA (containing putative specific sites)

  • Add increasing concentrations of unlabeled competitor DNA (specific vs. non-specific)

  • Calculate ratio of specific/non-specific DNA needed for 50% displacement

  • Specific binding typically shows 10-100 fold preference for target sequences

Salt Dependence Profiling:

  • Non-specific DNA binding is primarily electrostatic and highly salt-sensitive

  • Measure binding affinity (Kd) across NaCl concentrations (50-500 mM)

  • Plot log(Kd) vs. log[NaCl] - steeper slopes indicate higher electrostatic contribution

  • Specific binding typically shows less salt dependence due to additional sequence-specific contacts

Binding Kinetics Discrimination:

  • Measure association (kon) and dissociation (koff) rates using techniques like surface plasmon resonance

  • Non-specific binding typically has fast kon and koff rates

  • Specific binding often shows slower koff rates reflecting additional stabilizing interactions

  • Calculate specificity ratio (kon,specific/kon,non-specific) / (koff,specific/koff,non-specific)

Mutational Analysis:

  • Introduce systematic mutations in putative specific binding sequences

  • Quantify effect on binding affinity and correlate with sequence conservation

  • Test FtsK γ-domain mutants with altered DNA recognition properties

  • True specific binding shows sequence-dependent effects matching conservation patterns

By combining these approaches, you can develop a quantitative model of FtsK binding specificity, distinguishing genuine sequence preferences from general DNA affinity. Remember that FtsK likely exhibits a gradient of binding specificities rather than a simple binary specific/non-specific classification.

What approaches should I use to analyze the impact of FtsK mutations on chromosome segregation in S. epidermidis?

Analyzing the impact of FtsK mutations on chromosome segregation in S. epidermidis requires a multi-faceted approach combining genetics, microscopy, and molecular biology techniques:

Genetic Approaches:

  • Create a comprehensive mutation library targeting key FtsK domains:

    • Walker A and B motifs (K997A, D1121A) for ATPase activity

    • DNA-binding loops (R632A, K657A) for translocation

    • γ-domain mutations for directional control

    • N-terminal mutations affecting divisome localization

  • Develop complementation systems using:

    • Plasmid-based expression with inducible promoters

    • Chromosomal allele replacement with selection markers

    • Depletion strains with native ftsK under controllable promoters

Microscopy Analysis:

  • Fluorescence microscopy to visualize:

    • Nucleoid morphology and segregation (DAPI staining)

    • FtsK localization (GFP fusions)

    • Cell division sites (membrane stains)

  • Quantitative metrics to measure:

    • Frequency of anucleate cells (%)

    • Chromosome segregation timing

    • Colocalization coefficients for FtsK with the division septum

    • Cell morphology aberrations (elongation, tetrads)

Molecular Analysis:

  • Site-specific recombination assays:

    • Integrate dif-flanked cassettes in the S. epidermidis chromosome

    • Measure resolution efficiency in different FtsK mutants

    • Correlate with in vitro XerCD activation

  • Chromosome catenation analysis:

    • Pulsed-field gel electrophoresis to visualize chromosome dimers

    • Two-dimensional agarose gel electrophoresis for catenane identification

    • Quantification of topological forms in different mutants

Data Analysis Framework:

Analysis MethodKey MetricsExpected Outcomes in FtsK Mutants
Growth kineticsDoubling time, lag phaseIncreased doubling time, extended lag phase
Cell morphologyCell size distribution, tetradsIncreased frequency of tetrads or filaments
Nucleoid positioningNucleoid/cell length ratioNucleoid bisected by septa, uneven distribution
Chromosome segregation timingTime from replication to separationDelayed segregation, chromosome trapping
Recombination efficiencydif-cassette resolution (%)Reduced resolution with motor domain mutations

This integrated approach allows correlation between molecular defects and cellular phenotypes, providing mechanistic insights into how specific FtsK functions contribute to proper chromosome segregation in S. epidermidis.

How do I interpret discrepancies between in vitro DNA translocation rates and in vivo chromosome segregation dynamics?

Interpreting discrepancies between in vitro DNA translocation rates and in vivo chromosome segregation dynamics requires careful consideration of multiple factors that differ between these experimental contexts:

Key Factors Contributing to Discrepancies:

  • Cellular Environment Effects

    • Molecular crowding in vivo (300-400 mg/ml macromolecules) can alter protein-DNA interactions

    • DNA-bound proteins in vivo create roadblocks absent in purified systems

    • Supercoiling states differ between in vitro linear DNA and in vivo chromosomes

    • Ionic conditions in vivo fluctuate and differ from optimized in vitro buffers

  • Regulatory Mechanisms

    • Post-translational modifications may alter FtsK activity in vivo

    • Protein-protein interactions with divisome components can modulate function

    • Cell cycle-dependent regulation affects when and where FtsK is active

    • ATP/ADP ratios vary with cellular metabolic state

  • Experimental Limitations

    • In vitro measurements often use motor domain fragments rather than full-length protein

    • DNA substrates lack full chromosomal context including KOPS-like sequences

    • Single-molecule measurements may not represent ensemble behavior

    • Temperature differences between standard in vitro assays (25°C) and physiological conditions (37°C)

Reconciliation Approaches:

  • Scaling Factors Analysis

    • Determine temperature-dependent scaling factors (typical Q10 = 2-3)

    • Calculate activity adjustments for physiological protein concentrations

    • Apply corrections for differences in ATP concentration and supercoiling

  • Integrative Modeling

    • Develop mathematical models incorporating both in vitro parameters and in vivo constraints

    • Use stochastic simulations to account for probabilistic behavior of single molecules

    • Include factors like protein abundance, chromosome structure, and cell geometry

  • Bridging Experiments

    • Extract bacterial nucleoids for ex vivo translocation assays

    • Perform in vivo single-molecule tracking of labeled FtsK

    • Develop cell-free systems with physiological protein concentrations

    • Use temperature-controlled microfluidics to match in vivo conditions

Remember that discrepancies often reveal biologically significant regulatory mechanisms rather than experimental artifacts. A systematic approach to reconciling in vitro and in vivo data can provide insights into how FtsK activity is modulated in the cellular context to coordinate chromosome segregation with cell division in S. epidermidis.

What are the current gaps in our understanding of S. epidermidis FtsK and future research directions?

Despite significant advances in understanding bacterial FtsK proteins, several knowledge gaps remain specifically for S. epidermidis FtsK that represent important future research directions:

  • Species-Specific Sequence Recognition

    • The S. epidermidis equivalent of KOPS sequences remains unidentified

    • Genome-wide mapping of FtsK binding sites is needed

    • The conservation of the γ-domain's DNA recognition specificity across species requires investigation

  • Integration with Biofilm Biology

    • How FtsK function changes in biofilm versus planktonic growth states

    • Potential links between chromosome segregation defects and persistence in biofilms

    • Impact of FtsK mutations on biofilm formation on medical devices

  • Clinical Relevance and Antimicrobial Applications

    • Potential of FtsK as a novel antimicrobial target in multidrug-resistant S. epidermidis

    • Structural differences from human proteins that could be exploited

    • Impact of FtsK mutations on virulence and colonization ability

  • Comprehensive Structure-Function Analysis

    • High-resolution structures of S. epidermidis FtsK in different functional states

    • Species-specific structural features compared to model organisms

    • Complete mapping of interaction surfaces with other divisome components

  • Systems-Level Integration

    • Coordination between FtsK activity and other cell cycle processes

    • Quantitative models of chromosome segregation incorporating FtsK dynamics

    • Single-cell variability in FtsK expression and activity

These research directions will help establish S. epidermidis FtsK as a model system for understanding chromosome segregation in clinically relevant commensals and opportunistic pathogens, potentially leading to novel approaches for managing S. epidermidis infections associated with indwelling medical devices .

How might our understanding of FtsK contribute to developing novel antimicrobial strategies against S. epidermidis?

FtsK's essential role in chromosome segregation and cell division makes it a promising target for novel antimicrobial strategies against S. epidermidis, particularly for biofilm-associated infections on medical devices. Several possible approaches include:

1. Direct Inhibition Strategies:

  • Small molecule inhibitors targeting the ATPase activity of FtsK

  • Compounds disrupting the hexamer formation necessary for DNA translocation

  • Peptides interfering with FtsK-XerD interactions to prevent chromosome dimer resolution

  • DNA mimetics that compete for the DNA-binding interfaces of FtsK

2. Adjuvant Approaches:

  • FtsK inhibitors that sensitize S. epidermidis biofilms to conventional antibiotics

  • Compounds targeting persister cell formation by disrupting chromosome segregation

  • Biofilm dispersal agents working through FtsK-dependent mechanisms

3. Targeted Delivery Systems:

  • Medical device coatings releasing FtsK inhibitors to prevent biofilm establishment

  • Nanoparticle-based delivery of inhibitors to existing biofilms

  • Bacteriophage-delivered CRISPR systems targeting ftsK genes

4. Structure-Based Design Opportunities:

  • The unique ATP-binding pocket architecture of FtsK offers species-selective targeting

  • DNA-binding loops contain conserved basic residues that could be targeted by rational design

  • Interfaces between FtsK and other divisome proteins present additional targeting opportunities

5. Advantages as an Antimicrobial Target:

  • Essential for bacterial survival, reducing resistance development

  • No human homolog with similar function, minimizing toxicity concerns

  • Accessible to inhibitors due to its localization at the division septum

  • Targeting chromosome segregation may be particularly effective against slow-growing cells in biofilms

The development of FtsK inhibitors would represent a novel class of antimicrobials with a mechanism of action distinct from current antibiotics, potentially addressing the growing problem of S. epidermidis infections associated with indwelling medical devices . This approach could be particularly valuable against multidrug-resistant strains that are increasingly common in healthcare settings.

What specialized equipment and resources are essential for studying S. epidermidis FtsK?

Comprehensive investigation of S. epidermidis FtsK requires access to specialized equipment and resources spanning various disciplines:

Protein Expression and Purification:

  • ÄKTA purification systems with multi-wavelength detection

  • Preparative ultracentrifuges (≥ 40,000 rpm) for membrane fractionation

  • Automated chromatography systems with temperature control

  • Nano-DSF for protein thermal stability assessment

  • Dynamic light scattering for oligomeric state analysis

Functional Biochemistry:

  • Stopped-flow spectrophotometry for rapid kinetics

  • Micro-scale thermophoresis for interaction analysis

  • Isothermal titration calorimetry for thermodynamic parameters

  • Spectrophotometers with temperature control for coupled enzymatic assays

  • Fluorescence polarization systems for DNA binding studies

Structural Biology:

  • Access to cryo-electron microscopy facilities (300kV microscope ideal)

  • High-performance computing clusters for image processing

  • Small-angle X-ray scattering for solution structure analysis

  • NMR spectrometers for studying protein dynamics

  • Molecular graphics workstations with specialized software

Single-Molecule Analysis:

  • Magnetic tweezers apparatus for DNA manipulation

  • Total internal reflection fluorescence microscopy

  • Optical tweezers for force measurements

  • Microfluidic platforms for controlled reaction environments

  • High-speed cameras for real-time observation

Microbiology and Genetics:

  • Controlled environment chambers for S. epidermidis culture

  • Fluorescence microscopy with environmental control

  • Electroporation systems optimized for Staphylococcus

  • Flow cytometry with cell sorting capabilities

  • Real-time PCR for expression analysis

Computational Resources:

  • Molecular dynamics simulation capability

  • Sequence analysis and structural modeling software

  • Image analysis pipeline for microscopy data

  • Statistical analysis packages for complex datasets

  • Database access for comparative genomics

Critical Reagents:

  • S. epidermidis-optimized plasmid vectors

  • Antibodies specific to S. epidermidis FtsK

  • Purified XerCD recombinases for interaction studies

  • Synthetic DNA substrates with defined topologies

  • Metabolic labeling reagents for in vivo studies

This comprehensive set of resources provides the technical foundation for rigorous investigation of FtsK structure, function, and biological role in S. epidermidis, enabling multidisciplinary approaches that bridge biochemistry, structural biology, and microbiology.

What are the recommended standardized protocols for comparing FtsK activity across different bacterial species?

Standardized protocols for comparing FtsK activity across bacterial species are essential for meaningful comparative analysis. The following framework ensures consistency and reproducibility:

1. Protein Preparation Standardization:

  • Express C-terminal motor domains (FtsKαβγ) with identical affinity tags

  • Purify using identical buffer systems and chromatography steps

  • Verify hexamer formation by size-exclusion chromatography

  • Confirm protein quality by circular dichroism and thermal stability assays

  • Standardize storage conditions (-80°C in 20% glycerol)

2. ATP Hydrolysis Assay:

ParameterStandardized Condition
Temperature37°C
pH7.5 (HEPES buffer)
[ATP]1 mM
[MgCl₂]10 mM
[NaCl]150 mM
[Protein]50 nM (hexamer)
DNA substrate48 bp linear dsDNA (5 nM)
Detection methodNADH-coupled assay (340 nm)

3. DNA Translocation Assay:

  • Use identical triplex displacement substrates with conserved sequence design

  • Maintain consistent DNA concentration (1 nM) and length (3 kb linear)

  • Standardize hexamer:DNA ratio (10:1)

  • Employ identical fluorescence detection parameters

  • Calculate rates using the same mathematical models

4. Single-Molecule Analysis:

  • Use identical DNA tethering chemistry

  • Standardize buffer viscosity and ionic strength

  • Apply consistent force (5 pN) in magnetic tweezers experiments

  • Analyze translocation events using uniform criteria

  • Track minimum of 100 individual molecules per species

5. Data Normalization Approach:

  • Express activities relative to E. coli FtsK as reference standard

  • Report temperature-normalized values (corrected to 37°C)

  • Calculate specific activity per hexamer

  • Include confidence intervals based on biological replicates

  • Document batch-to-batch variation with control experiments

6. Minimum Reporting Standards:

  • Full sequence details of constructs used

  • Detailed purification protocols including yields

  • SDS-PAGE and size exclusion chromatography profiles

  • Specific activity measurements with standard deviation

  • Raw data availability in public repositories

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.