Recombinant Staphylococcus epidermidis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Kinetic Parameters

PlsY’s enzymatic activity is central to bacterial membrane synthesis. Key biochemical data include:

ParameterValueConditionsSource
Vₘₐₓ (Maximum Velocity)57.5 μmol·min⁻¹·mg⁻¹Detergent micelles, 30°C
Kₘ (G3P)1.14 mMMicellar assay, pH 7.5
Kₘ (acylP)6.2 μMMicellar assay, pH 7.5
IC₅₀ (LPA Inhibition)19 μMCompetitive inhibition assay

PlsY exhibits Michaelis-Menten kinetics in detergent micelles, with lysophosphatidic acid (LPA) acting as a competitive inhibitor .

Recombinant Protein Production

Recombinant PlsY is expressed in E. coli for structural and functional studies. Key production details:

PropertyDetailSource
Expression SystemE. coli, with N-terminal His-tag for purification
Protein LengthFull-length (1–202 amino acids)
PurityPurified via affinity chromatography
ActivityFunctional in lipid bilayer environments; supports membrane synthesis

The His-tagged recombinant protein (Cat. No. RFL1697SF) is used in high-throughput assays to screen PlsY inhibitors .

Clinical and Therapeutic Relevance

PlsY’s role in pathogenic S. epidermidis strains underscores its potential as a drug target:

  1. Antimicrobial Target:

    • PlsY inhibitors disrupt membrane phospholipid synthesis, critical for bacterial viability .

    • High-throughput assays using recombinant PlsY enable rapid screening of small-molecule inhibitors .

  2. Association with Pathogenic Strains:

    • S. epidermidis ST2 strains, linked to bloodstream infections, harbor mobile genetic elements (e.g., pICE-Sepi-ST2) that modulate virulence .

    • PlsY’s ubiquity in Gram-positive pathogens (e.g., Streptococcus pneumoniae) makes it a conserved target .

Research Challenges and Future Directions

ChallengeOpportunityRelevant Data
Membrane Protein HandlingDevelopment of micellar assays enables high-throughput screeningKinetic parameters in detergent systems
Inhibitor SpecificityStructural insights guide rational drug design (e.g., targeting acylP/G3P binding sites)Crystallographic data
Off-Target EffectsPlsY’s absence in humans reduces toxicity risks for inhibitorsPhylogenetic analysis

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; SE_1035; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 12228)
Target Names
plsY
Target Protein Sequence
MMIIVMLILSYLIGAFPSGLIIGKLFFKKDIRQYGSGNTGATNSFRVLGRPAGFIVTFLD IFKGFITVFFPLWFSVHADGVISTFFTNGLIVGLFAILGHVYPIYLKFNGGKAVATSAGV VLGVNPILLLILAIIFFSVLKIFKYVSLSSIIAAISCVIGSIIIHDYILLAVSGIVSIIL IIRHKSNIVRIFKGEEPKIKWM
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: sep:SE1035

STRING: 176280.SE1035

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus epidermidis PlsY and why is it significant?

Staphylococcus epidermidis PlsY is a membrane-integral glycerol 3-phosphate (G3P) acyltransferase that catalyzes the committed and essential step in bacterial phospholipid biosynthesis. This enzyme acylates glycerol 3-phosphate to form lysophosphatidic acid, which is a crucial intermediate in membrane phospholipid formation .

The significance of PlsY stems from several unique characteristics:

  • It represents a distinct class of acyltransferase that exists exclusively in bacteria with no eukaryotic homologs .

  • It uses acyl-phosphate as an acyl donor, unlike other acyltransferases that utilize acyl-CoA or acyl-carrier protein .

  • It is essential in most Gram-positive bacteria, including clinically relevant pathogens like Enterococcus faecium and Streptococcus pneumoniae .

  • It has been identified as a potential target for developing novel antimicrobials, particularly against drug-resistant pathogens .

S. epidermidis itself is a leading nosocomial pathogen that causes chronic rather than acute infections, distinguishing it from its more aggressive relative S. aureus .

What is the structural architecture of S. epidermidis PlsY?

S. epidermidis PlsY exhibits a distinctive structural architecture that provides insights into its function. Key structural features include:

  • A seven-transmembrane helix fold, as revealed by high-resolution crystal structure determination at 1.48 Å resolution .

  • A relatively inflexible active site, as demonstrated by substrate- and product-bound structures .

  • A relatively small size of approximately 200 residues, but with extreme hydrophobicity that had previously hindered structure determination efforts .

The crystal structure determination of PlsY represents a significant breakthrough in understanding this enzyme, as its high hydrophobicity and membrane-integral nature had previously presented challenges to structural studies . The availability of high-resolution structural data now enables more precise investigations into the enzyme's mechanism and facilitates structure-based drug design approaches.

How does PlsY differ from other acyltransferases?

PlsY differs from conventional acyltransferases in several fundamental ways:

  • Unique acyl donor: PlsY uses acyl-phosphate as its acyl donor, while conventional acyltransferases like PlsB use thioesters (acyl-CoA or acyl-carrier protein) .

  • Catalytic mechanism: PlsY employs a different acylation mechanism termed 'substrate-assisted catalysis' that does not require a proteinaceous catalytic base to complete the reaction, unlike other acyltransferases .

  • Structural features: PlsY lacks known acyltransferase motifs found in other enzymes that perform similar functions .

  • Evolutionary distribution: PlsY exists exclusively in bacteria with no eukaryotic homologs, whereas the conventional GPAT PlsB has eukaryotic counterparts .

These differences make PlsY a unique class of acyltransferase and highlight its potential as a specific target for antibacterial drug development, as compounds targeting PlsY would be unlikely to affect host enzymes due to the absence of homologous proteins in eukaryotes .

What is the biochemical function of PlsY in bacterial metabolism?

PlsY plays a critical role in bacterial phospholipid biosynthesis through the following functions:

  • It catalyzes the committed step in bacterial membrane phospholipid biosynthesis by acylating glycerol 3-phosphate (G3P) to form lysophosphatidic acid (LPA) .

  • This reaction represents the first acylation step in the pathway leading to the synthesis of phosphatidic acid, which serves as the precursor for various membrane phospholipids .

  • In most Gram-positive bacteria such as Enterococcus faecium and Streptococcus pneumoniae, PlsY is the sole and therefore essential glycerol 3-phosphate acyltransferase (GPAT) .

  • In Gram-negative bacteria like Escherichia coli that contain both GPATs (PlsB and PlsY), deletion of both PlsY and the acyl-phosphate-synthesizing enzyme PlsX is lethal, suggesting the essentiality of the PlsX/PlsY pathway .

The biochemical function of PlsY is integrated with the activity of PlsX, which synthesizes the acyl-phosphate substrate used by PlsY. This interdependence highlights the importance of the PlsX/PlsY pathway in bacterial lipid metabolism and cell viability .

What experimental approaches are optimal for expressing and purifying recombinant S. epidermidis PlsY?

Expressing and purifying membrane proteins like S. epidermidis PlsY presents unique challenges that require specialized approaches. Based on successful structure determination studies, the following methodology is recommended:

  • Expression system selection:

    • Bacterial expression systems (E. coli) with specialized strains optimized for membrane protein expression

    • Consider using C41(DE3) or C43(DE3) strains that are designed to tolerate toxic membrane proteins

    • Employ tightly regulated promoters (e.g., T7lac) to control expression levels

  • Fusion tags and constructs:

    • Incorporate affinity tags (His6 or His10) at either N- or C-terminus for purification

    • Consider fusion proteins like maltose-binding protein (MBP) to enhance solubility

    • Test multiple construct designs with varying tag positions and linker lengths

  • Membrane extraction and solubilization:

    • Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

    • Optimize detergent concentration through small-scale screening

    • Consider lipid supplementation during solubilization to maintain protein stability

  • Purification strategy:

    • Employ multi-step purification including:
      a) Immobilized metal affinity chromatography (IMAC)
      b) Size exclusion chromatography (SEC)
      c) Optional ion exchange chromatography for further purity

    • Maintain detergent above critical micelle concentration throughout purification

    • Include stability-enhancing additives (glycerol, specific lipids) in purification buffers

  • Quality assessment:

    • Evaluate homogeneity by SEC and dynamic light scattering

    • Assess functionality through enzymatic activity assays

    • Verify structural integrity via circular dichroism or thermal stability assays

The extreme hydrophobicity of PlsY necessitates careful optimization of each step to maintain the native conformation of the protein throughout the purification process .

How can researchers develop high-throughput enzymatic assays for PlsY activity studies?

Developing robust high-throughput enzymatic assays for PlsY is essential for inhibitor screening and mechanistic studies. Based on successful approaches mentioned in the literature, researchers should consider the following methodological framework:

  • Substrate preparation:

    • Synthesize acyl-phosphate substrates using chemical methods or enzymatically using recombinant PlsX

    • Prepare glycerol-3-phosphate at high purity

    • Consider fluorescently labeled or radiolabeled substrates for increased sensitivity

  • Assay formats:

    • Spectrophotometric coupled assays measuring phosphate release

    • Fluorescence-based assays monitoring changes in environmentally sensitive probes

    • HPLC or LC-MS approaches for direct product quantification

    • Miniaturized formats compatible with 384- or 1536-well plates

  • Detection methods:

    • For phosphate detection: malachite green or molybdate-based colorimetric methods

    • For direct product detection: develop LC-MS/MS methods with multiple reaction monitoring

    • Consider developing fluorescence polarization assays for binding studies

  • Assay optimization parameters:

    • Buffer composition (pH, ionic strength)

    • Detergent type and concentration

    • Temperature and reaction time

    • Enzyme concentration to ensure linear kinetics

    • Substrate concentrations based on Km values

  • Validation criteria:

    • Z'-factor determination (aim for >0.7)

    • Signal-to-background ratio optimization

    • Coefficient of variation <10%

    • DMSO tolerance assessment

    • Positive and negative control inclusion

Previous work has demonstrated the feasibility of developing high-throughput enzymatic assays for PlsY, which should prove useful for virtual and experimental screening of inhibitors against this vital bacterial enzyme .

What are the challenges and solutions for structural studies of membrane proteins like PlsY?

Structural studies of membrane proteins such as PlsY face several challenges due to their hydrophobic nature and instability when removed from the lipid bilayer. Here are the key challenges and methodological solutions:

  • Challenges in crystal formation:

    • Limited polar surface area for crystal contacts

    • Detergent micelles can interfere with crystal packing

    • Conformational heterogeneity in detergent solutions

    • Tendency to aggregate during concentration

  • Solutions for crystallization:

    • Lipidic cubic phase (LCP) crystallization

    • Bicelle-based crystallization approaches

    • Antibody fragment-mediated crystallization to increase polar surfaces

    • Thermostabilizing mutations to reduce conformational flexibility

    • Use of fusion partners designed for membrane protein crystallization (e.g., T4 lysozyme)

  • Alternative structural approaches:

    • Cryo-electron microscopy for larger membrane protein complexes

    • Solid-state NMR for smaller membrane proteins in native-like environments

    • Hydrogen-deuterium exchange mass spectrometry for dynamics and conformational studies

  • Computational approaches:

    • Molecular dynamics simulations in explicit membrane environments

    • Homology modeling based on related structures

    • Integrative structural biology combining multiple experimental data sources

The successful determination of PlsY's crystal structure at 1.48 Å resolution represents a remarkable achievement given these challenges. Four additional substrate- and product-bound structures provide atomic details of its relatively inflexible active site, which is valuable information for structure-based drug design .

How does the catalytic mechanism of PlsY differ from conventional acyltransferases?

The catalytic mechanism of PlsY represents a unique paradigm in enzyme catalysis that differs substantially from conventional acyltransferases. Key differences include:

  • Substrate-assisted catalysis:

    • PlsY employs a "substrate-assisted catalysis" mechanism that does not require a proteinaceous catalytic base

    • The substrate itself (likely the phosphate group of G3P) acts as the catalytic base

  • Acyl donor chemistry:

    • PlsY uses acyl-phosphate as the acyl donor, which has different chemical reactivity compared to the thioesters (acyl-CoA/acyl-ACP) used by conventional acyltransferases

    • The acyl-phosphate mixed anhydride bond has higher energy, potentially facilitating transfer

  • Active site architecture:

    • PlsY has a relatively inflexible active site as revealed by substrate- and product-bound structures

    • The seven-transmembrane helix fold creates a unique active site environment

  • Proposed reaction mechanism:

    • The hydroxyl group of G3P likely attacks the carbonyl carbon of the acyl-phosphate

    • The phosphate group of G3P may act as a general base to abstract the proton from its own hydroxyl group

    • This creates an alkoxide nucleophile that attacks the acyl-phosphate

    • The reaction proceeds through a tetrahedral intermediate before collapsing to form LPA

This distinctive mechanism explains why PlsY lacks the canonical catalytic motifs found in other acyltransferases and highlights the evolutionary diversity of enzymes catalyzing similar reactions .

What approaches can be used to identify and validate potential inhibitors of S. epidermidis PlsY?

Identifying and validating potential inhibitors of S. epidermidis PlsY requires a multi-faceted approach combining computational methods, in vitro assays, and cellular studies:

  • Structure-based virtual screening:

    • Utilize the high-resolution crystal structure (1.48 Å) for molecular docking

    • Focus on the active site and substrate binding regions

    • Implement molecular dynamics simulations to account for protein flexibility

    • Apply pharmacophore modeling based on known substrates and acyl-phosphate analogs

  • Rational design approaches:

    • Design acyl-phosphate mimetics that can compete with natural substrate

    • Previous studies have identified acyl-sulfamates as potential PlsY-inhibiting antimicrobials for Staphylococcus aureus

    • Focus on non-hydrolyzable analogs of the transition state

  • In vitro validation methods:

    • Implement the high-throughput enzymatic assay mentioned previously

    • Determine IC50 and Ki values for promising compounds

    • Assess mechanism of inhibition (competitive, non-competitive, uncompetitive)

    • Evaluate selectivity against human acyltransferases

  • Binding confirmation studies:

    • Isothermal titration calorimetry (ITC)

    • Surface plasmon resonance (SPR)

    • Thermal shift assays to assess compound-induced stabilization

    • Co-crystallization attempts with high-affinity inhibitors

  • Cellular and microbiological evaluation:

    • Determine minimum inhibitory concentrations (MICs) against S. epidermidis

    • Assess cytotoxicity against mammalian cell lines

    • Evaluate membrane integrity and phospholipid composition in treated bacteria

    • Use genetic approaches (PlsY overexpression) to confirm on-target activity

The availability of the PlsY crystal structure and development of high-throughput enzymatic assays provide powerful tools for virtual and experimental screening of inhibitors against this vital bacterial enzyme .

How can genetic recombination techniques be applied to study PlsY function in S. epidermidis?

Genetic recombination techniques offer powerful approaches to study PlsY function in S. epidermidis, enabling researchers to investigate its role in bacterial physiology and pathogenesis:

  • Gene knockout and complementation studies:

    • Since PlsY is essential, conditional knockout systems are necessary

    • Implement inducible antisense RNA expression to downregulate plsY

    • Use CRISPR interference (CRISPRi) with dCas9 for conditional repression

    • Complement with wild-type or mutant versions on plasmids for functional rescue

  • Site-directed mutagenesis approaches:

    • Target conserved residues identified from structural studies

    • Create alanine-scanning libraries across the protein

    • Generate mutations in the transmembrane domains to assess structural importance

    • Develop point mutations in residues predicted to interact with substrates

  • Domain swapping experiments:

    • Exchange domains between PlsY homologs from different bacterial species

    • Create chimeric constructs to identify species-specific functional elements

    • Swap transmembrane helices to determine their contribution to substrate specificity

  • Reporter fusion systems:

    • Create translational fusions with fluorescent proteins for localization studies

    • Develop transcriptional fusions to monitor expression under different conditions

    • Implement split protein complementation assays to study protein-protein interactions

  • Phenotypic analysis of recombinants:

    • Assess membrane phospholipid composition by mass spectrometry

    • Evaluate growth characteristics under various stress conditions

    • Measure biofilm formation capacity of PlsY mutants

    • Investigate virulence in appropriate infection models

How should researchers design experiments to study the role of PlsY in S. epidermidis pathogenesis?

Designing experiments to investigate the role of PlsY in S. epidermidis pathogenesis requires careful consideration of multiple factors to ensure valid and reproducible results:

  • Defining experimental variables:

    • Independent variable: PlsY expression/activity levels (wild-type, mutants, conditional knockdowns)

    • Dependent variables: Biofilm formation, adherence to surfaces, survival in host immune defenses, virulence in infection models

    • Control variables: Growth conditions, bacterial density, genetic background

  • Hypothesis formulation:

    • Develop specific, testable hypotheses about PlsY's role in particular pathogenic mechanisms

    • Example hypothesis: "Reduced PlsY activity decreases S. epidermidis biofilm formation by altering membrane phospholipid composition"

  • Experimental treatments:

    • Design treatments that manipulate PlsY activity through genetic or chemical means

    • Consider dose-response relationships for chemical inhibitors

    • Include appropriate positive and negative controls

  • Subject assignment:

    • For in vitro studies: Implement technical and biological replicates

    • For animal models: Random assignment to treatment groups, appropriate sample size determination

    • Consider both between-subjects and within-subjects designs where appropriate

  • Measuring dependent variables:

    • Quantitative assessment of biofilm formation using crystal violet staining

    • Flow cytometry to evaluate bacterial interactions with immune cells

    • Transcriptomic/proteomic analysis to identify downstream effects

    • In vivo imaging in animal models to track infection progression

Researchers should also consider that S. epidermidis has strategies to evade neutrophil killing, including resistance mechanisms to antimicrobial peptides (AMPs) such as the protease SepA and the AMP sensor/resistance regulator Aps (GraRS) . These factors may interact with PlsY-dependent processes and should be accounted for in experimental designs.

What controls are essential when studying recombinant S. epidermidis PlsY?

When studying recombinant S. epidermidis PlsY, implementing appropriate controls is crucial for generating reliable and interpretable data:

  • Expression and purification controls:

    • Empty vector control (expression host with vector lacking PlsY gene)

    • Inactive mutant control (catalytically dead version of PlsY)

    • Tag-only control (expression of affinity tag without PlsY)

    • Positive control (well-characterized membrane protein expressed under identical conditions)

  • Enzymatic activity controls:

    • No-enzyme control (reaction mixture without PlsY)

    • Heat-inactivated enzyme control (denatured PlsY)

    • Substrate specificity controls (non-physiological substrates)

    • Inhibition positive control (known inhibitor at saturating concentration)

  • Structural and biophysical controls:

    • Detergent-only samples for background subtraction

    • Reference protein of known structure for calibration

    • Negative stain electron microscopy to confirm sample homogeneity

    • Thermal denaturation profiles to verify protein folding

  • Genetic manipulation controls:

    • Wild-type parent strain (unmodified S. epidermidis)

    • Vector-only control for complementation studies

    • Housekeeping gene control for expression studies

    • Off-target control for CRISPR-based approaches

  • Statistical and experimental design controls:

    • Technical replicates (minimum triplicate measurements)

    • Biological replicates (independent bacterial cultures)

    • Randomization of sample processing order

    • Blinding of samples during analysis when possible

How can researchers integrate structural data with functional studies of PlsY?

Integrating structural data with functional studies of PlsY creates powerful opportunities for understanding this enzyme's mechanism and developing targeted interventions:

  • Structure-guided mutagenesis:

    • Identify residues in the crystal structure likely involved in:

      • Substrate binding

      • Catalysis

      • Conformational changes

      • Protein-protein interactions

    • Generate point mutations at these sites and assess functional consequences

    • Create a structure-function map correlating specific residues with enzymatic parameters

  • Molecular dynamics simulations:

    • Use the high-resolution crystal structure (1.48 Å) as starting point

    • Simulate PlsY behavior in a membrane environment

    • Model substrate binding and product release

    • Identify transient interaction networks not visible in static structures

  • Ligand binding studies informed by structure:

    • Design fragments or compounds predicted to bind specific pockets

    • Use biophysical methods to confirm binding (SPR, ITC, etc.)

    • Develop structure-activity relationships

    • Perform competition assays with native substrates

  • Integrative structural biology approaches:

    • Complement crystal structure with solution techniques (SAXS, HDX-MS)

    • Use cryo-EM to capture different conformational states

    • Apply cross-linking mass spectrometry to map interaction surfaces

    • Validate structural findings with in vivo functional assays

  • Comparison with related enzymes:

    • Align PlsY structure with other acyltransferases

    • Identify structural features unique to PlsY that explain its distinct mechanism

    • Transfer functional insights between homologous enzymes

    • Explore evolutionary relationships through structure-based phylogeny

The availability of substrate- and product-bound structures of PlsY provides particularly valuable insights into the relatively inflexible active site, which can guide the design of highly specific inhibitors .

What statistical approaches are appropriate for analyzing PlsY enzyme kinetics data?

Analyzing PlsY enzyme kinetics data requires appropriate statistical methods to ensure reliable interpretation of results:

  • Enzyme kinetics model fitting:

    • Michaelis-Menten equation fitting using non-linear regression

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations for visual analysis

    • Global fitting approaches for multiple datasets

    • Analysis of residuals to assess goodness of fit

  • Parameter estimation and uncertainty:

    • Calculate Km, Vmax, kcat, and kcat/Km with confidence intervals

    • Bootstrap analysis to determine robustness of parameter estimates

    • Monte Carlo simulations to propagate measurement errors

    • Sensitivity analysis to identify influential data points

  • Inhibition studies analysis:

    • Determination of inhibition constants (Ki)

    • Competitive vs. non-competitive vs. uncompetitive model discrimination

    • IC50 determination and conversion to Ki based on substrate concentration

    • Dose-response curve fitting with appropriate equations

  • Comparison between experimental conditions:

    • ANOVA for comparing multiple conditions

    • t-tests for pairwise comparisons (with appropriate corrections for multiple testing)

    • Non-parametric alternatives when normality assumptions are violated

    • Mixed-effects models for nested experimental designs

  • Quality control and outlier detection:

    • Dixon's Q test or Grubbs' test for outlier identification

    • Systematic error detection through quality control charts

    • Assessment of homoscedasticity in residuals

    • Evaluation of technical versus biological variability

Statistical TestApplicationAssumptionsExample Use Case
Non-linear regressionFitting enzyme kinetic modelsHomoscedastic errors, independenceDetermining Km and Vmax for PlsY with different acyl-phosphate substrates
ANOVAComparing multiple experimental conditionsNormality, equal variancesComparing activity of wild-type PlsY vs. multiple mutants
Student's t-testComparing two conditionsNormality, equal variancesComparing PlsY activity in the presence vs. absence of specific lipids
Mann-Whitney U testNon-parametric comparisonIndependenceComparing inhibition when normality cannot be assumed
Chi-square goodness of fitTesting model adequacyIndependence, sufficient sample sizeComparing different inhibition models

How can researchers effectively compare PlsY from different bacterial species?

Comparing PlsY enzymes from different bacterial species requires systematic approaches that integrate multiple levels of analysis:

  • Sequence-based comparisons:

    • Multiple sequence alignment to identify conserved residues

    • Phylogenetic analysis to establish evolutionary relationships

    • Calculation of sequence identity and similarity percentages

    • Identification of species-specific sequence motifs or insertions/deletions

  • Structural comparisons:

    • Superposition of crystal structures (if available)

    • Homology modeling for species lacking experimental structures

    • Root mean square deviation (RMSD) calculation for backbone and side chains

    • Analysis of active site architecture and substrate binding pockets

  • Biochemical parameter comparison:

    • Standardized kinetic assays under identical conditions

    • Substrate specificity profiles with diverse acyl-phosphate donors

    • Temperature and pH activity profiles

    • Inhibition susceptibility patterns

  • Comparative expression analysis:

    • Codon usage optimization for heterologous expression

    • Expression level quantification in native hosts

    • mRNA stability and translational efficiency assessment

    • Protein half-life determination

  • Functional complementation studies:

    • Cross-species gene replacement experiments

    • Assessment of growth rates and phospholipid profiles in complemented strains

    • Stress response characterization of hybrid strains

    • Virulence factor expression in complemented mutants

SpeciesPlsY StructureSubstrate PreferenceDisease AssociationReference
S. epidermidis7 transmembrane helicesMedium-chain acyl-phosphatesNosocomial infections, biofilm-associated
S. aureusSimilar to S. epidermidisMedium-chain, branched acyl-phosphatesAcute infections, toxin production
E. faeciumPredicted similar topologyNot fully characterizedMultidrug resistant infections
S. pneumoniaeConfirmed by structural studiesMedium-chain acyl-phosphatesRespiratory infections

Understanding these species-specific differences can provide insights into bacterial adaptation and guide the development of species-targeted antimicrobial strategies.

What are the current challenges in developing PlsY inhibitors as antimicrobials?

Developing PlsY inhibitors as antimicrobials faces several significant challenges that researchers must address:

  • Target site accessibility:

    • PlsY's seven transmembrane helix structure presents a barrier for inhibitor access

    • The active site may be partially embedded in the membrane

    • Inhibitors need to cross the bacterial cell wall and membrane

    • For Gram-negative pathogens, the outer membrane provides an additional barrier

  • Inhibitor design challenges:

    • Acyl-phosphate mimetics often have poor pharmacokinetic properties

    • Achieving selectivity against mammalian acyltransferases

    • Balancing membrane permeability with target binding

    • Addressing potential for rapid resistance development

  • Biochemical challenges:

    • Developing consistent sources of acyl-phosphate substrates for assays

    • Creating stable, active recombinant enzyme preparations

    • Standardizing assay conditions across research groups

    • Correlating in vitro inhibition with whole-cell activity

  • Biological challenges:

    • Potential for bypass mechanisms or compensatory pathways

    • Species-specific differences in PlsY structure and function

    • Biofilm formation providing additional protection against inhibitors

    • Variability in expression levels during infection

  • Drug development challenges:

    • Optimizing lead compounds for drug-like properties

    • Addressing toxicity concerns early in development

    • Establishing appropriate animal models for efficacy testing

    • Demonstrating advantages over existing antimicrobials

Previous studies have synthesized and screened acyl-phosphate analogs, identifying several acyl-sulfamates as potential PlsY-inhibiting antimicrobials for Staphylococcus aureus . The recent determination of the high-resolution crystal structure of PlsY should facilitate structure-based drug design approaches to overcome some of these challenges .

How might PlsY research contribute to understanding S. epidermidis pathogenesis?

Research on PlsY has significant potential to enhance our understanding of S. epidermidis pathogenesis through multiple mechanisms:

  • Membrane phospholipid composition effects:

    • PlsY activity influences membrane phospholipid acyl chain composition

    • Membrane composition affects biofilm formation capability

    • Altered membrane properties impact antibiotic susceptibility

    • Changes in surface charge affect host-pathogen interactions

  • Integration with virulence mechanisms:

    • S. epidermidis employs a passive defense approach to evade neutrophil killing

    • PlsY-dependent membrane composition may influence antimicrobial peptide resistance

    • Potential interactions with the protease SepA and AMP sensor/resistance regulator Aps (GraRS)

    • Correlation between phospholipid composition and phenol-soluble modulin (PSM) production

  • Biofilm development insights:

    • Phospholipids serve as precursors for biofilm matrix components

    • PlsY activity may influence cell-cell communication within biofilms

    • Changes in membrane fluidity affect adhesion to medical devices

    • Potential role in persistence and chronic infection establishment

  • Metabolic adaptations during infection:

    • PlsY function under different host environmental conditions

    • Utilization of host-derived lipids as acyl donor sources

    • Metabolic shifts between planktonic and biofilm lifestyles

    • Energy allocation between growth and persistence

  • Evolutionary considerations:

    • Comparison with S. aureus reveals adaptation of biological activities within one family of virulence determinants (PSMs)

    • Parallel evolution of PlsY function and passive defense strategies

    • Selective pressures shaping PlsY structure and activity

    • Host-specific adaptations in acyl chain preferences

S. epidermidis causes chronic rather than acute infections, in contrast to its more aggressive relative S. aureus . Understanding PlsY's role in this distinct pathogenic strategy may reveal new approaches to combat biofilm-associated infections while providing fundamental insights into bacterial adaptation to different ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.