Recombinant Staphylococcus epidermidis Heme sensor protein hssS (hssS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hssS; SERP1954; Heme sensor protein HssS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
hssS
Target Protein Sequence
MFKTLYSRIAIYAITVILFSALMSFLFTNIYYHFHLKASNDAKIMRTLKEAREYERTQKP KPLDTYLKHLGQMNYQIMTVNEHGTKHFYGETFRKNTISQSAIKKVLNGEDYHGIKNKPY AFFVTGFFDNETDNTVGIQFKTDDGALAVFMRPDIGETFSEFRIFLAVLITLLLIISISL VIASTYSIIKPVTALKNATTRIMKGDFSTPIKQTRHDEIGTLQSRFNTMRQNLGQVDQMR QHFVQNVSHEVKTPLTHLQRLLTQLELTQNEEEKQLCINEMFEITNQVSELTKELLLLSE LDNASHLTFNDNVHLNTLIKDIIRHEQFRTDEKDLVMFTELEDLYFRGNERLLHQAFNNL IINAMNYAPQNSMINITLTSTNHLIIFNIENDGSIAEEDAKHIFDRFYKLSDESSSNGLG LAITQSIIHLHHGSITLTSDDKTQFIVKLFI
Uniprot No.

Target Background

Function
Recombinant *Staphylococcus epidermidis* Heme sensor protein hssS (hssS) is a component of the two-component regulatory system HssS/HssR, crucial for intracellular heme homeostasis and modulation of staphylococcal virulence. HssS functions as a heme-sensing histidine kinase, undergoing autophosphorylation at a histidine residue before transferring the phosphate group to an aspartate residue on HssR. The HssR/HssS complex subsequently activates expression of the *hrtAB* efflux pump in response to extracellular heme, hemin, hemoglobin, or blood.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the HssS protein in Staphylococcus epidermidis and what is its primary function?

HssS (heme sensing system S) is a membrane sensor protein that functions as part of a two-component sensing system (HssRS) in S. epidermidis. This protein plays a crucial role in bacterial defense against heme toxicity by detecting environmental heme and initiating a signaling cascade. As a HisKA-type histidine kinase, HssS exists as a membrane-bound homodimer with an extracellular sensor domain and a cytoplasmic catalytic domain . When activated by heme, HssS triggers a phosphotransfer mechanism that ultimately leads to the expression of the efflux transporter HrtBA, which extrudes excess heme from the bacterial cell, preventing cytotoxicity . This system is particularly important for S. epidermidis survival in blood-rich environments where heme concentrations can reach toxic levels.

How does S. epidermidis HssS compare to homologous proteins in other Staphylococcal species?

S. epidermidis HssS shares approximately 64% sequence identity with its S. aureus counterpart . This significant homology suggests conservation of core functional domains and similar mechanisms of action. Both proteins serve as membrane sensors for heme and operate within the HssRS two-component system to activate the expression of heme detoxification machinery. Structural predictions using AlphaFold2 indicate that both proteins likely contain similar heme-binding pockets at the interface between the membrane and extracellular domains . Despite these similarities, species-specific variations in certain amino acid residues may contribute to subtle differences in sensitivity, activation thresholds, or response dynamics. Understanding these nuances is important when developing species-targeted interventions or when using one species as a model for studying the other.

Why is the study of HssS important in clinical microbiology?

The study of HssS is clinically significant for several reasons:

  • S. epidermidis is one of the most prevalent causes of nosocomial infections, particularly in immunocompromised patients and those with indwelling medical devices .

  • Approximately 70% of S. epidermidis strains in healthcare settings exhibit methicillin resistance, and the species demonstrates considerable genetic diversity with several epidemic clonal lineages disseminated worldwide .

  • S. epidermidis forms robust biofilms on medical implants, contributing to antibiotic tolerance and immune evasion . Understanding heme sensing systems may provide insights into biofilm formation mechanisms, particularly in blood-contacting devices.

  • HssS represents a potential target for novel antimicrobial strategies that could disrupt bacterial heme homeostasis without targeting essential metabolic pathways, potentially reducing selective pressure for resistance.

  • The HssRS-HrtBA system constitutes a defense mechanism when bacteria are exposed to lysed erythrocytes , making it particularly relevant for understanding infections associated with vascular damage or hemolysis.

What is known about the structural features of S. epidermidis HssS that enable heme sensing?

Based on structural modeling and functional studies of the homologous protein in S. aureus, S. epidermidis HssS contains a distinctive structural architecture that enables specific heme sensing:

  • HssS functions as a membrane-bound homodimer with an extracellular sensor domain and a cytoplasmic histidine kinase domain .

  • Structural simulations indicate the presence of a hydrophobic cavity within the transmembrane domain helices at the interface with the extracellular domain that forms the heme-binding site .

  • This binding pocket positions heme such that it embeds within the membrane bilayer while its protruding porphyrin propionates interact with conserved arginine residues (Arg94 and Arg163 in S. aureus) located extracellularly .

  • Two highly conserved phenylalanine residues (Phe25 and Phe128 in S. aureus) are believed to contribute to the hydrophobic pocket that accommodates the heme molecule .

  • This structural arrangement allows HssS to function as a "gatekeeper" that can detect heme at the membrane/extracellular interface, initiating signaling to activate heme detoxification mechanisms without requiring heme to fully enter the bacterial cell .

How does the HssS-mediated phosphotransfer mechanism function to trigger HrtBA expression?

The HssS-mediated phosphotransfer mechanism follows a classic two-component system signaling pathway with unique features specific to heme sensing:

What experimental evidence indicates that HssS specifically senses membrane-associated heme rather than cytoplasmic heme?

Several lines of experimental evidence suggest that HssS specifically senses membrane-associated heme rather than cytoplasmic heme:

  • Structural modeling identifies a heme-binding site at the membrane-extracellular interface, with the heme molecule positioned partially embedded in the membrane bilayer .

  • Mutations in the conserved arginine residues (Arg94 and Arg163) and phenylalanine residues (Phe25 and Phe128) that form the predicted binding pocket significantly reduce or abolish HssS activation, confirming the importance of this specific structural domain for heme sensing .

  • Wild-type HssS copurifies with heme when expressed in E. coli, whereas variants with mutations in the putative binding pocket show strongly attenuated heme binding .

  • The kinetics of HssS activation show a transient response pattern even in strains lacking the HrtBA efflux system (which would presumably maintain high intracellular heme levels), suggesting that the sensing mechanism may be responding to a membrane-specific signal rather than total cellular heme concentration .

  • Different kinetics of HssS activation are observed when bacteria are exposed to free hemin versus hemoglobin, with the latter producing a slower and more sustained response, consistent with differential delivery of heme to the membrane environment .

What expression systems are most effective for producing recombinant S. epidermidis HssS protein?

While specific information about recombinant expression of S. epidermidis HssS is limited in the provided search results, effective expression systems for membrane sensor proteins like HssS typically include:

  • E. coli Expression Systems: The search results indicate that wild-type HssS successfully copurified with heme when expressed in E. coli , suggesting that E. coli can be an effective heterologous host for HssS expression. Common E. coli strains used for membrane protein expression include C41(DE3), C43(DE3), and BL21(DE3) with pLysS plasmid to control leaky expression.

  • S. carnosus as a Surrogate Host: For functional studies requiring a Gram-positive background, S. carnosus TM300 has been used successfully as a surrogate host for staphylococcal membrane proteins . This strain is mentioned in the search results as being used to confirm the presence of protein fragments on the bacterial surface.

  • Expression Tags Optimization: For purification and detection purposes, C-terminal HA-tagged versions of HssS have been successfully employed in S. aureus studies , suggesting similar approaches may work for S. epidermidis HssS.

  • Inducible Promoter Systems: Controlled expression using systems like the pBAD promoter (arabinose-inducible) or the T7 promoter with IPTG induction allows for optimization of expression levels to avoid toxicity associated with membrane protein overexpression.

The choice of expression system should consider the intended use of the recombinant protein (structural studies, functional assays, antibody production) and whether native conformation and heme-binding capacity need to be preserved.

What reporter systems can be used to monitor HssS activation and HrtBA expression in laboratory settings?

Several reporter systems have been successfully employed to monitor HssS activation and subsequent HrtBA expression:

  • β-Galactosidase (β-gal) Reporter System: The search results describe the use of a PhrtBA-lac fusion (plasmid pPhrtBA-lac) to measure HrtBA promoter activity in response to heme concentration . This system responds linearly to increasing concentrations of exogenously supplied hemin, making it suitable for quantitative analysis.

  • GFP Reporter System: A fluorescent reporter system using the PhrtBA promoter linked to GFP (plasmid pPhrtBA-GFP) has been used to monitor the kinetics of HssS stimulation by heme . This system allows for real-time monitoring of HssS activation throughout bacterial growth.

  • Western Blot Detection: Direct detection of HrtB protein levels using specific antibodies provides a direct measure of the HssRS-regulated response. This approach has been used alongside HA-tagged HssS to simultaneously monitor both the sensor and the effector components of the system .

  • Pyridine Hemochrome Assay: While not a direct reporter of HssS activity, this assay has been used to quantify intracellular heme accumulation in wild-type versus ΔhrtBA mutants, providing a complementary measure to validate HssS-HrtBA system functionality .

These reporter systems can be combined with various mutant backgrounds (e.g., ΔhssRS, ΔhrtBA) to dissect specific aspects of the signaling pathway and response dynamics.

What methodologies are most reliable for studying the interaction between HssS and heme at the molecular level?

To investigate the molecular interactions between HssS and heme, several complementary approaches can be employed:

  • Structural Prediction and Docking: As demonstrated in the search results, structural simulation of the HssS dimer based on AlphaFold2, combined with heme docking, can provide valuable insights into potential binding sites and interacting residues . This computational approach generates testable hypotheses about specific amino acids involved in heme recognition.

  • Site-Directed Mutagenesis: Targeted substitution of predicted heme-interacting residues (such as the conserved arginines and phenylalanines identified in S. aureus HssS) followed by functional assays can validate the importance of specific amino acids for heme sensing .

  • Heme Co-Purification Assays: The ability of recombinant HssS to copurify with heme when expressed in E. coli provides a direct measure of heme-binding capacity . Comparing wild-type HssS with mutant variants allows quantification of binding affinity changes.

  • UV-Visible Spectroscopy: Though not explicitly mentioned in the search results, this technique is commonly used to detect heme-protein interactions through characteristic spectral shifts when heme binds to proteins.

  • Isothermal Titration Calorimetry (ITC): This biophysical method can determine binding affinities, stoichiometry, and thermodynamic parameters of heme-HssS interactions.

  • Surface Plasmon Resonance (SPR): SPR can measure real-time binding kinetics between immobilized HssS (or specific domains) and heme in solution.

  • Membrane Reconstitution Systems: Reconstituting purified HssS into liposomes or nanodiscs can provide a more native-like membrane environment for studying heme interactions and conformational changes in response to binding.

How does the HssS-HrtBA system contribute to S. epidermidis survival in host environments?

The HssS-HrtBA system provides S. epidermidis with a crucial defense mechanism against heme toxicity in host environments:

  • Protection from Heme Toxicity: In the host bloodstream, bacteria are exposed to heme from lysed erythrocytes. Heme can concentrate in bacterial lipid membranes, generating cytotoxicity through oxidative damage . By sensing heme accumulation and triggering the expression of the HrtBA efflux system, HssS helps prevent this toxicity.

  • Maintenance of Membrane Integrity: The "gatekeeper" mechanism proposed for HssS limits intracellular diffusion of exogenous heme , helping maintain membrane integrity and function, which is essential for bacterial survival.

  • Adaptation to Blood-Rich Environments: The ability to manage heme levels is particularly important for S. epidermidis colonization of intravascular devices such as prosthetic heart valves or vascular grafts, where exposure to blood components is constant .

  • Support for Biofilm Formation: While not directly linked in the search results, heme homeostasis may indirectly support S. epidermidis biofilm formation on implanted devices. Biofilms provide protection against host immune responses and antibiotics , and managing environmental stressors like heme toxicity could facilitate the initial stages of biofilm establishment.

  • Navigating Host Iron Restriction: The host restricts iron availability as an innate defense against pathogens. The HssS-HrtBA system allows S. epidermidis to precisely balance the acquisition of iron (via heme) with protection against heme toxicity, optimizing survival in iron-limited host environments.

What is the relationship between HssS function and biofilm formation in S. epidermidis?

While the search results do not directly address the relationship between HssS function and biofilm formation in S. epidermidis, several inferences can be made based on the available information:

  • Biofilm Formation as a Major Virulence Factor: S. epidermidis causes some of the most difficult-to-treat clinical infections by forming biofilms on medical implants, which support immune evasion and antibiotic tolerance .

  • Potential Indirect Connections: The HssS-HrtBA system, by managing heme toxicity, may indirectly support bacterial survival during the initial attachment phase of biofilm formation, particularly on blood-contacting devices where heme exposure would be significant.

  • Environmental Sensing and Adaptation: As a sensor kinase, HssS represents part of the broader environmental sensing capability of S. epidermidis. The ability to detect and respond to host-derived molecules (like heme) could be integrated with other sensing systems that regulate biofilm formation.

  • Stress Response Coordination: Heme toxicity represents an environmental stress, and bacterial stress responses are often coordinated with biofilm formation. The signaling pathways downstream of HssS activation might intersect with biofilm regulatory networks.

  • Population Structure Considerations: S. epidermidis has an epidemic population structure with nine major clonal lineages disseminated worldwide . The distribution and potential variations of the HssS-HrtBA system across these lineages could contribute to differences in biofilm formation capacity and virulence.

Further research is needed to directly investigate whether heme sensing through HssS influences biofilm formation processes, such as initial attachment, extracellular matrix production, or dispersal.

What is known about variations in the hssS gene across different S. epidermidis isolates and their impact on virulence?

  • High Genetic Diversity: S. epidermidis shows considerable genetic diversity, with 217 isolates being split into 74 different sequence types by multilocus sequence typing (MLST) .

  • Clonal Population Structure: Despite this diversity, S. epidermidis has an epidemic population structure with nine major clonal lineages. One single clonal lineage (clonal complex 2) comprises 74% of isolates, while the remaining isolates cluster into 8 minor clonal lineages and 13 singletons .

  • Recombination and Mutation: Recombination appears to give rise to new alleles approximately twice as frequently as point mutations during S. epidermidis clonal diversification . This high rate of recombination could potentially affect the hssS gene.

  • Variable Presence of Virulence Genes: The genome of S. epidermidis is highly variable, and not all isolates possess the same repertoire of genes for host colonization and biofilm formation . By analogy, the hssS gene or its sequence variants might show variable distribution across clinical isolates.

  • Distribution in Clinical Isolates: While not specifically addressing hssS, the search results note that some virulence factors like the adhesive protein Embp are present in two-thirds of S. epidermidis isolates from orthopedic device-related infections and 90% of isolates from bloodstream infections .

A comprehensive analysis of hssS sequence variations across different S. epidermidis lineages, particularly those associated with different types of infections, would be valuable for understanding the potential role of this gene in virulence adaptation.

How might the HssS-HrtBA system interact with other stress response mechanisms in S. epidermidis?

The interaction between the HssS-HrtBA system and other stress response mechanisms in S. epidermidis represents an important area for future research:

  • Integration with Iron Homeostasis Systems: Heme is an important iron source, and the HssS-HrtBA system likely interacts with iron acquisition and storage systems to balance heme detoxification with iron utilization.

  • Coordination with Oxidative Stress Responses: Heme can generate reactive oxygen species, potentially activating oxidative stress response systems. Cross-talk between HssS signaling and oxidative stress regulons (such as those controlled by PerR or OxyR-like regulators) would provide a coordinated response to heme-induced oxidative damage.

  • Connection to Cell Envelope Stress Responses: Since HssS senses heme at the membrane interface , there may be functional overlap with systems that detect and respond to membrane integrity challenges or cell envelope stress.

  • Regulatory Network Integration: As a two-component system, HssRS likely integrates with the broader regulatory network governing stress adaptation in S. epidermidis. Identifying transcriptional targets of HssR beyond hrtBA could reveal connections to other stress response pathways.

  • Biofilm-Associated Stress Responses: Given the importance of biofilms in S. epidermidis pathogenesis , investigating how heme sensing and detoxification integrate with biofilm-associated stress responses could provide insights into adaptation during device-associated infections.

Research approaches to address these questions might include transcriptomic analysis comparing wild-type and ΔhssS mutants under various stress conditions, protein-protein interaction studies to identify partners of HssS/HssR, and genetic screens for synthetic phenotypes when hssS mutations are combined with mutations in other stress response regulators.

What are the key methodological challenges in developing inhibitors targeting the HssS-HrtBA system?

Developing inhibitors targeting the HssS-HrtBA system presents several methodological challenges:

  • Membrane Protein Target Complexity: HssS is a membrane-bound sensor with multiple domains . Developing assays that maintain the native confirmation and functionality of HssS for inhibitor screening is technically challenging.

  • Specificity Considerations: Given the homology between S. epidermidis HssS and homologs in other bacteria (including commensal staphylococci), achieving species-specific inhibition might be difficult. Structural and functional differences between S. epidermidis HssS and human heme-binding proteins must be characterized to avoid off-target effects.

  • Assay Development Challenges: Establishing high-throughput screening assays for HssS inhibitors requires reporter systems that specifically reflect HssS activity. While PhrtBA promoter-based reporters have been developed , adapting these for large-scale screening would need optimization.

  • Membrane Penetration: Effective inhibitors would need to reach HssS at the bacterial membrane interface. Designing molecules with appropriate physicochemical properties to penetrate the Gram-positive cell wall and access the membrane-bound target presents formidable medicinal chemistry challenges.

  • Resistance Development Assessment: Methods to evaluate the potential for resistance development against HssS inhibitors would be needed, including long-term exposure experiments and assessment of compensatory mechanisms that might bypass HssS-HrtBA function.

  • In vivo Efficacy Models: Developing relevant animal models that specifically assess the contribution of HssS inhibition to infection control, particularly in the context of device-associated biofilms, would be necessary for translational advancement.

Addressing these challenges would require interdisciplinary approaches combining structural biology, medicinal chemistry, microbial genetics, and infection models specifically designed to evaluate interventions targeting this system.

What role might horizontal gene transfer play in the evolution and distribution of the hssS gene in staphylococcal species?

The potential role of horizontal gene transfer in the evolution and distribution of the hssS gene can be considered in light of what we know about S. epidermidis population genetics and mobile genetic elements:

  • High Recombination Rates: S. epidermidis shows evidence of significant recombination, with new alleles arising through recombination approximately twice as frequently as through point mutations . This suggests a species with substantial horizontal gene exchange.

  • Mobile Genetic Elements: S. epidermidis acquires and transfers genetic material through various mobile genetic elements. For example, the SCCmec element carrying methicillin resistance was acquired at least 56 times by S. epidermidis according to evolutionary models .

  • Epidemic Population Structure: S. epidermidis has an epidemic population structure where nine clones have emerged upon a recombining background and evolved rapidly through frequent transfer of mobile genetic elements . This pattern suggests that horizontally acquired genes, potentially including hssS, could spread rapidly through the population if they confer selective advantages.

  • Cross-Species Transfer Potential: Given the similarity between S. epidermidis HssS and S. aureus HssS (64% identity) , previous horizontal transfer events between staphylococcal species may have occurred. Analyzing the phylogenetic distribution and sequence conservation of hssS across the Staphylococcus genus could provide evidence of such transfers.

  • Ecological Context: S. epidermidis and other staphylococci coexist in various ecological niches, including human skin and hospital environments, providing opportunities for genetic exchange. The selective pressures in these environments (including exposure to heme from blood) might drive the maintenance and spread of functional hssS genes.

Research approaches to address this question could include comparative genomic analyses of the hssS locus across diverse staphylococcal isolates, examination of flanking sequences for evidence of mobile genetic element insertion sites, and experimental studies of hssS transfer frequencies under various selective conditions.

Table 1: Genetic diversity of S. epidermidis clinical isolates based on MLST analysis

ParameterValueNotes
Total isolates analyzed217Representative collection from diverse geographic and clinical origins
Number of MLST types identified74Indicates high genetic diversity
Major clonal lineageClonal complex 2Comprises 74% of isolates
Minor clonal lineages8Alongside 13 singleton sequence types
Index of association between alleles0.2898 (P<0.05)Supports clonality of S. epidermidis species
Recombination vs. mutation ratio~2:1Recombination generates new alleles approximately twice as frequently as point mutations
SCCmec acquisition eventsAt least 56 timesAccording to evolutionary model

Table 2: Key residues involved in HssS heme sensing based on S. aureus studies

ResiduePositionFunctionEffect of Mutation
Arginine94Interacts with heme porphyrin propionatesLimits ability to induce HrtBA synthesis
Arginine163Interacts with heme porphyrin propionatesLimits ability to induce HrtBA synthesis
Phenylalanine25Forms part of hydrophobic heme-binding pocketLimits ability to induce HrtBA synthesis
Phenylalanine128Forms part of hydrophobic heme-binding pocketLimits ability to induce HrtBA synthesis
Threonine253Involved in phosphatase activityT253A substitution increases HssS activity

Table 3: Reporter systems for monitoring HssS-HrtBA activity

Reporter SystemConstructApplicationResponse Characteristics
β-galactosidasepPhrtBA-lacQuantitative measurement of hrtBA promoter activityResponds linearly to increasing heme concentrations
GFP fluorescencepPhrtBA-GFPReal-time monitoring of HssS activation kineticsShows transient activation pattern with peak after a few hours post-heme addition
Western blotAnti-HrtB antibodiesDirect measurement of HrtB protein levelsCorrelates with promoter activity measured by reporter systems
Pyridine hemochromeN/A (biochemical assay)Measurement of intracellular heme accumulationΔhrtBA mutant accumulates approximately twice more heme than wild-type

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.