Recombinant Staphylococcus epidermidis Histidine protein kinase saeS (saeS)

Shipped with Ice Packs
In Stock

Description

Structure and Function

SaeS is a member of the HisKA family of histidine protein kinases and is predicted to have a sensing domain with two transmembrane segments connected by a short extracellular loop . It is an intramembrane-sensing kinase . The kinase activity of SaeS determines the level of phosphorylated SaeR (SaeR-P) . SaeS contains 351 amino acids, with His131 being the phosphorylation site .

Mechanism of Action

SaeS likely has both kinase and phosphatase activity, similar to the EnvZ/OmpR system in Escherichia coli . The ratio of phosphorylated SaeR (SaeR-P) to unphosphorylated SaeR determines which genes are activated . A high proportion of SaeR needs to be phosphorylated for some target genes to be activated, while others can be activated with fewer SaeR-P molecules .

SaeS Variants

The Staphylococcus aureus strain Newman has a single amino acid change in the sensory domain of SaeS (Pro18 in strain Newman [SaeS<sup>P</sup>], compared with Leu18 in other strains [SaeS<sup>L</sup>]) . SaeS<sup>P</sup> determines activation of class I sae target genes (coa, fnbA, eap, sib, efb, fib, sae), which are highly expressed in strain Newman . Class II target genes (hla, hlb, cap) are not sensitive to the SaeS polymorphism . SaeS<sup>L</sup> is dominant over the SaeS<sup>P</sup> allele . SaeS<sup>P</sup> has high kinase activity, and its signal response is altered .

Role in Virulence

The SaeRS TCS is a major regulator of secreted toxins and exoenzymes . It is essential for virulence in animal models of infection and plays a critical role in evading the innate immune response .

Interaction with Staphylococcus epidermidis

Staphylococcus epidermidis can inhibit the hemolytic activity of Staphylococcus aureus by down-regulating the activity of the SaeRS TCS . A heat-sensitive metabolite produced by S. epidermidis may contribute to the suppression of S. aureus .

Sensing of Signals

The N-terminal domain of SaeS (two transmembrane helices and the extracellular loop) functions as a unit in a tripwire manner . The conformation of the N-terminal domain controls the kinase activity of HK . Conformational changes in the N-terminal domain can either repress or activate the kinase activity of HK .

Regulation by Fatty Acids

Bacterial fatty acids can inhibit SaeS activity by affecting the sensing of the SaeS transmembrane domain . Human skin fatty acids can also display antistaphylococcal activity by repressing the SaeRS TCS .

Tables

Table 1: Comparison of SaeS variants

FeatureSaeS<sup>L</sup>SaeS<sup>P</sup>
Amino acid at position 18Leucine (Leu)Proline (Pro)
ActivityLower kinase activityHigher kinase activity
Target gene activationLower class I gene expressionHigher class I gene expression
Sensitivity to detergentsInhibited by SDSFurther increased kinase activity by SDS
StabilityStableUnstable without SaeQ; subject to degradation

Table 2: SaeRS Two-Component System

ComponentDescription
SaeSSensor histidine kinase; senses environmental signals and phosphorylates SaeR.
SaeRResponse regulator; activated by phosphorylation via SaeS, binds to DNA, and regulates the expression of virulence genes in S. aureus.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
saeS; SERP0364; Histidine protein kinase SaeS; Sensor protein SaeS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
saeS
Target Protein Sequence
MTIFSIRSQIIIGVISSVILTTIILVIAYKLMWFNGHMTLTLAITTMITSCLTLSICSIF INPLIQKIKQFNIKTKQFINHEKFIDDETFQSPREIKELNDSFNKMAYEINNQMNMIKNE QQEKTEIIQNLAHDLKTPLAGIRSYSEGLRDGVISDPQEVHEAYEILIKQANRLSILFDD ITHVINLNTGRSYPLELIQLDQLLVNILQPYEQHIKQENRTLEVNFCTDIDAFYQYRPPI ERILTNLLDNALKFSNSGSRIDIIISECKENDVISISIKDEGIGIVPELQSRIFERTFRV EDSRNTKTGGSGLGLYIANELAQQIDASITVQSDLDIGTTMTLTLKKFQFKK
Uniprot No.

Target Background

Function

SaeS is a member of the two-component regulatory system SaeR/SaeS. It likely functions as a membrane-associated protein kinase. Upon sensing an appropriate signal, it autophosphorylates and subsequently activates the cytosolic response regulator SaeR.

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of the SaeS protein in Staphylococcus epidermidis?

SaeS is an intramembrane-sensing histidine kinase containing a simple N-terminal domain composed of two transmembrane helices and a nine amino acid-long extracytoplasmic linker peptide, along with a C-terminal kinase domain . This structural arrangement allows SaeS to function as a molecular switch, maintaining low but significant basal kinase activity that can be upregulated in response to specific inducing signals such as human neutrophil peptide 1 (HNP1) . The simplicity of its structure belies the sophistication of its function, as the transmembrane domains and linker peptide work in concert to transduce external signals to the internal kinase domain.

What is the role of the extracytoplasmic linker peptide in SaeS function?

The nine-amino acid extracytoplasmic linker peptide of SaeS plays a crucial regulatory role in controlling the protein's basal kinase activity . Research has demonstrated that this linker peptide is highly optimized for its function, with very specific amino acid sequences that are essential for proper signal transduction . When the linker peptide is absent, SaeS displays aberrantly elevated kinase activity even without inducing signals and fails to respond to stimuli like HNP1 . Additionally, alanine substitution experiments have shown that altering the amino acids in the linker peptide can significantly affect both basal kinase activity and responsiveness to HNP1, indicating the precision with which this small peptide regulates SaeS function .

How does SaeS function within the SaeRS two-component system?

SaeS functions as the sensor component within the SaeRS two-component system (TCS), which is essential for in vivo survival of S. epidermidis . As a histidine kinase, SaeS senses specific environmental stimuli and initiates a phosphorelay system by autophosphorylating a conserved histidine residue in its kinase domain . This phosphate group is subsequently transferred to an aspartate residue on its cognate response regulator (SaeR), activating it to regulate gene expression . The TCS architecture allows bacteria to sense and respond to environmental stimuli, and in the case of SaeRS, it regulates various processes including virulence factor expression and antibiotic resistance mechanisms .

What methods are most effective for recombinant expression of S. epidermidis SaeS?

For recombinant expression of S. epidermidis SaeS, an experimental research approach utilizing E. coli expression systems with carefully optimized conditions is most effective. The protocol should incorporate the following methodological considerations:

  • Vector selection: pET-based vectors with T7 promoters are recommended for membrane protein expression

  • E. coli strain: BL21(DE3) or C41(DE3) strains specifically designed for membrane protein expression

  • Expression conditions: Induction at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM)

  • Membrane extraction: Utilizing mild detergents such as n-dodecyl-β-D-maltoside (DDM) for solubilization

Experimental research with SaeS must account for its transmembrane domains, which can present challenges for expression and purification . Importantly, when designing constructs, researchers should ensure the critical nine-amino acid linker peptide is preserved, as its removal results in aberrant kinase activity that would compromise experimental validity .

How can researchers effectively assess SaeS kinase activity in experimental settings?

Assessment of SaeS kinase activity requires a systematic experimental research approach combining in vitro biochemical assays with in vivo validation methods:

Assay TypeMethodologyMeasured ParametersAdvantagesLimitations
In vitro autophosphorylationPurified SaeS protein incubated with [γ-32P]ATPRate of 32P incorporationDirect measurement of kinase activityMay not reflect in vivo conditions
Phosphotransfer assaysCo-incubation of SaeS with SaeR and [γ-32P]ATPRate of phosphate transfer to SaeRMeasures complete signaling eventRequires purification of both proteins
Reporter gene fusionFusion of SaeR-regulated promoters to reporter genes (e.g., lux, gfp)Light/fluorescence productionAllows in vivo monitoringIndirect measurement
Quantitative RT-PCRRNA extraction and qPCR of SaeR-regulated genesTranscript levels of target genesHigh sensitivity, measures natural targetsDownstream of kinase activity

When analyzing SaeS variants with modifications in the linker peptide region, researchers should compare both basal kinase activity and responsiveness to inducing signals such as HNP1, as both parameters can be differentially affected by specific amino acid substitutions .

What experimental controls are essential when studying HNP1-induced activation of SaeS?

When studying HNP1-induced activation of SaeS, several critical experimental controls must be implemented to ensure valid and reproducible results:

  • Negative controls:

    • SaeS variants lacking the extracytoplasmic linker peptide (which display constitutive activity regardless of HNP1 presence)

    • Heat-inactivated HNP1 to control for non-specific protein interactions

    • Non-inducing antimicrobial peptides to confirm specificity

  • Positive controls:

    • Wild-type SaeS with established HNP1 response parameters

    • Known SaeS activators (if available) to confirm system functionality

  • Dose-response analysis:

    • Titration of HNP1 concentrations to establish activation thresholds

    • Time-course experiments to determine kinetics of activation

  • System validation controls:

    • Monitoring of downstream gene expression to confirm functional signal transduction

    • Parallel experiments with SaeS variants containing alanine substitutions in the linker peptide to identify critical residues

  • Technical controls:

    • Protein stability assays to ensure observed differences are not due to altered protein degradation

    • Membrane integration verification to confirm proper protein localization

How does the evolutionary optimization of the SaeS linker peptide contribute to bacterial pathogenesis?

The SaeS linker peptide represents a highly evolved feature with optimized amino acid sequences that are critical for its function as a regulatory switch in S. epidermidis . Evolutionary analysis reveals that this optimization likely occurred through positive selection pressure related to pathogenesis. The linker peptide's precise composition allows SaeS to maintain appropriate basal kinase activity while remaining responsive to host defense molecules like HNP1 .

From a pathogenesis perspective, this optimization enables S. epidermidis to:

  • Maintain virulence gene expression at appropriate basal levels in commensal states

  • Rapidly upregulate virulence factors upon detection of host immune responses

  • Fine-tune its response to varying concentrations of antimicrobial peptides

  • Conserve energy by preventing unnecessary expression of virulence factors

Experimental evidence supports this evolutionary significance, as alanine substitution experiments demonstrate that nearly any alteration to the linker peptide results in either dysregulated basal activity or impaired signal responsiveness . This suggests that the natural sequence has been refined through evolution to provide optimal pathogenic capability while minimizing fitness costs, highlighting how small structural elements can have outsized effects on bacterial virulence regulation.

What molecular mechanisms explain the differential responses of SaeS variants to inducing signals?

The differential responses of SaeS variants to inducing signals can be explained through several molecular mechanisms that influence signal transduction:

  • Conformational coupling alterations: Modifications in the linker peptide affect how conformational changes propagate from the sensor domain to the kinase domain . Specific amino acid substitutions can either enhance or impede this mechanical coupling.

  • Ligand binding affinity changes: Certain amino acids in the linker peptide may directly participate in forming the binding pocket for inducing molecules like HNP1 . Substitutions can therefore alter binding affinity or specificity.

  • Transmembrane helix positioning: The linker peptide influences the relative orientation of the two transmembrane helices. Changes in this orientation can alter the baseline conformation of the kinase domain, explaining the observed changes in basal activity .

  • Dimerization interface modifications: Two-component histidine kinases typically function as dimers. Alterations in the linker peptide may affect dimerization dynamics, influencing both basal activity and signal response.

  • Membrane microdomain localization: The linker peptide composition may determine SaeS localization within specific membrane microdomains, affecting its access to inducing signals and interaction partners.

These mechanisms are not mutually exclusive and likely work in concert to produce the finely tuned response characteristics of wild-type SaeS. Research utilizing high-resolution structural analysis combined with molecular dynamics simulations would be valuable for further elucidating these complex mechanisms.

How might cross-talk between SaeS and other two-component systems affect antimicrobial resistance?

Cross-talk between SaeS and other two-component systems (TCS) represents a complex research area with significant implications for antimicrobial resistance (AMR). Although TCS are generally considered highly specific, evidence suggests several potential cross-talk mechanisms that could influence AMR:

  • Phosphotransfer promiscuity: Under certain conditions, SaeS may phosphorylate non-cognate response regulators that control AMR genes. This non-canonical signaling could activate resistance mechanisms even in the absence of their specific inducing signals.

  • Shared regulatory networks: SaeS-regulated genes may include transcription factors that influence expression of genes normally controlled by other TCS involved in AMR, creating indirect regulatory overlap.

  • Competitive ATP binding: As histidine kinases utilize a conserved ATP-binding region , drugs targeting this domain in SaeS might inadvertently affect other histidine kinases, potentially triggering compensatory resistance mechanisms.

  • Co-regulation of resistance determinants: Multiple TCS may converge on regulation of key resistance determinants, such as efflux pumps or cell wall synthesis machinery, creating redundant control systems that complicate antimicrobial targeting.

  • Horizontal gene transfer influence: The SaeRS system may affect expression of genes involved in conjugation or competence, indirectly influencing the acquisition of resistance genes, particularly in hospital environments where approximately 70% of S. epidermidis strains exhibit methicillin resistance .

Understanding these cross-talk mechanisms is particularly relevant for developing histidine kinase-targeted antimicrobial agents, as the CA domain of histidine kinases has been identified as a popular target in recent drug discovery studies .

How can SaeS research inform the development of novel histidine kinase-targeted antimicrobial agents?

SaeS research provides critical insights for developing novel histidine kinase (HK) targeted antimicrobial agents through several key mechanisms:

  • Structure-based drug design: The elucidation of SaeS structure, particularly its conserved ATP-binding catalytic and ATP-binding (CA) domain, provides specific targets for rational drug design . Compounds can be designed to competitively inhibit ATP binding or to allosterically alter kinase conformation.

  • Signaling disruption strategies: Understanding the specific role of the extracytoplasmic linker peptide in signal transduction enables the development of peptide mimetics or small molecules that interfere with signal sensing without triggering kinase activation .

  • Selectivity optimization: Comparative analysis of SaeS with other histidine kinases helps identify unique structural features that can be exploited to develop selective inhibitors, reducing off-target effects on human kinases.

  • Resistance prediction: Research on SaeS variants with altered linker peptide sequences provides insight into potential resistance mechanisms that might emerge against HK inhibitors, allowing preemptive design of combination therapies or inhibitors less prone to resistance .

  • In vivo efficacy enhancement: Knowledge that SaeS is essential for in vivo survival of S. epidermidis validates it as a high-value target and suggests that SaeS inhibitors might be particularly effective in clinical settings, even if in vitro activity appears modest .

The CA domain of histidine kinases has emerged as a popular target in recent drug discovery studies due to its highly conserved ATP-binding region across bacterial species . This conservation offers the potential for broad-spectrum activity, while careful design can maintain selectivity against human kinases.

What implications does the population structure of S. epidermidis have for targeting SaeS in clinical isolates?

The population structure of S. epidermidis has significant implications for targeting SaeS in clinical isolates, requiring careful consideration in antimicrobial development:

  • Clonal diversity considerations: Multilocus sequence typing (MLST) analysis has revealed that S. epidermidis exhibits high genetic diversity, with 217 isolates splitting into 74 sequence types . This diversity suggests potential variation in SaeS structure and function across lineages.

  • Epidemic clonal lineage targeting: Research has identified nine epidemic clonal lineages of S. epidermidis disseminated worldwide, with clonal complex 2 comprising 74% of isolates . Targeting SaeS variants common in this predominant clonal complex could maximize therapeutic impact.

  • Recombination frequency impacts: Sequence analysis indicates that recombination generates new alleles approximately twice as frequently as point mutations in S. epidermidis . This high recombination rate could accelerate the development of resistance to SaeS inhibitors, necessitating combination therapy approaches.

  • Mobile genetic element consideration: The frequent transfer of mobile genetic elements in S. epidermidis suggests that resistance to SaeS inhibitors could spread rapidly once it emerges. Surveillance systems would be crucial for early detection of resistance.

  • Geographic distribution assessment: The worldwide dissemination of major S. epidermidis clones indicates that effective SaeS inhibitors would need global efficacy testing against geographically diverse isolates.

The epidemic population structure of S. epidermidis, characterized by nine major clones emerging upon a recombining background , suggests that SaeS inhibitors might face both the challenge of existing diversity and rapid evolutionary adaptation.

What are the optimal experimental approaches for analyzing SaeS linker peptide variants?

The optimal experimental approach for analyzing SaeS linker peptide variants requires a comprehensive, multi-phase research design that combines molecular, biochemical, and functional analyses:

Phase 1: Variant Construction and Expression

  • Site-directed mutagenesis to generate systematic alanine substitutions across all nine amino acids of the linker peptide

  • Construction of deletion variants lacking the entire linker peptide as extreme phenotype controls

  • Expression in both heterologous (E. coli) and native (S. epidermidis) systems with appropriate tags for detection and purification

  • Verification of membrane integration and proper folding through protease accessibility assays and circular dichroism

Phase 2: Biochemical Characterization

  • In vitro autophosphorylation assays to measure basal kinase activity of each variant under standardized conditions

  • Phosphotransfer assays to evaluate signal transmission to the SaeR response regulator

  • Dose-response experiments with HNP1 to determine EC50 values for each variant

  • Binding assays to measure direct interaction with inducing signals such as HNP1

Phase 3: Functional Analysis in S. epidermidis

  • Complementation of saeS deletion mutants with variant constructs

  • Quantitative RT-PCR measurement of SaeR-regulated genes in response to stimuli

  • Antimicrobial peptide resistance assays to evaluate phenotypic consequences

  • Biofilm formation assays to assess impact on virulence-related behaviors

Phase 4: Structural Analysis

  • NMR spectroscopy of reconstituted transmembrane domains with various linker peptide variants

  • Molecular dynamics simulations to model conformational changes upon signal binding

  • Hydrogen-deuterium exchange mass spectrometry to identify regions with altered dynamics

This systematic approach enables researchers to correlate specific amino acid positions with distinct functional properties, providing mechanistic insight into how this highly optimized linker peptide controls both basal activity and signal responsiveness .

How should researchers approach contradictory data when studying SaeS signal transduction mechanisms?

When facing contradictory data while studying SaeS signal transduction mechanisms, researchers should implement a systematic analytical research approach:

  • Data verification and experimental validation:

    • Repeat experiments with increased technical and biological replicates

    • Verify reagent quality and experimental conditions

    • Implement alternative methodologies to measure the same parameter

    • Consider blind experimental design to minimize bias

  • Hypothesis reconciliation framework:

    • Develop competing hypotheses that could explain all observations

    • Design critical experiments specifically to differentiate between hypotheses

    • Consider whether contradictions might represent genuine biological complexity rather than experimental error

  • Contextual factors analysis:

    • Examine strain background differences (particularly relevant given S. epidermidis population structure)

    • Evaluate experimental conditions that might influence SaeS conformation or activity

    • Consider post-translational modifications or interacting proteins not accounted for in initial models

  • Multidisciplinary approach integration:

    • Combine biochemical, genetic, and structural approaches

    • Incorporate computational modeling to explore dynamic behaviors

    • Collaborate with specialists in complementary techniques

  • Systematic literature analysis:

    • Conduct meta-analysis of published work on similar systems

    • Identify patterns in contradictory findings across different research groups

    • Evaluate methodological differences that might explain discrepancies

This analytical research framework acknowledges that contradictory data often catalyzes scientific breakthroughs by revealing previously unrecognized complexity in biological systems . For SaeS specifically, contradictions might reveal context-dependent behaviors related to its role as a molecular switch with precisely calibrated activity levels .

What invention research approaches could lead to novel tools for studying SaeS function?

Several promising invention research approaches could yield innovative tools for studying SaeS function, following the principles of identifying needs in research and developing iterative solutions :

  • Biosensor development for real-time SaeS activity monitoring:

    • Design of fluorescent protein-based FRET sensors that respond to conformational changes in SaeS

    • Creation of split-luciferase complementation systems linked to SaeS and SaeR to visualize phosphotransfer in real time

    • Development of membrane-anchored fluorescent reporters that localize with SaeS and change properties upon activation

  • Optogenetic control systems for SaeS manipulation:

    • Engineering chimeric SaeS variants with light-sensitive domains that enable precise temporal control of kinase activity

    • Creation of photoactivatable HNP1 analogs that allow spatial control of SaeS activation

    • Development of light-controlled protein degradation systems for rapid SaeS depletion

  • Microfluidic platforms for single-cell SaeS dynamics:

    • Design of microfluidic devices that enable rapid changes in HNP1 concentration while monitoring cellular responses

    • Creation of gradient-generating platforms to study threshold effects in SaeS activation

    • Development of cell trapping systems for long-term observation of SaeS-mediated responses

  • Synthetic biology tools for SaeS pathway reconstruction:

    • Design of minimal synthetic systems that reconstruct the SaeRS pathway in heterologous hosts

    • Creation of modular genetic circuits that allow systematic testing of SaeS variants

    • Development of orthogonal two-component systems that can interface with SaeS without cross-talk

These invention research approaches follow the engineering design process outlined for invention research SAEs, which begins with identifying a need and involves iterative prototyping and testing . Each proposed tool addresses specific limitations in current methods for studying SaeS function and would enable new experimental capabilities for understanding this important histidine kinase.

What are the most promising future research directions for understanding the role of SaeS in S. epidermidis pathogenesis?

The most promising future research directions for understanding SaeS's role in S. epidermidis pathogenesis include:

  • Host-pathogen interaction dynamics:

    • Investigation of how human antimicrobial peptides beyond HNP1 interact with SaeS

    • Examination of tissue-specific signals that might modulate SaeS activity during colonization versus infection

    • Analysis of how SaeS activity changes during different stages of biofilm formation on medical devices

  • Structural biology advancements:

    • High-resolution structural determination of the complete SaeS protein, including transmembrane domains and linker peptide

    • Cryo-EM studies of SaeS in complex with SaeR to understand the full signaling complex

    • Time-resolved structural studies to capture conformational changes during signal transduction

  • Systems biology integration:

    • Comprehensive transcriptomic and proteomic profiling of SaeS-dependent responses across diverse clinical isolates

    • Network analysis of interactions between SaeRS and other regulatory systems in S. epidermidis

    • Mathematical modeling of SaeS signal transduction kinetics and their impact on virulence gene expression

  • Evolutionary and population genetics:

    • Comparative analysis of SaeS sequence variation across the nine epidemic clonal lineages of S. epidermidis

    • Investigation of how frequent genetic recombination events in S. epidermidis influence SaeS function

    • Assessment of selective pressures on saeS genes during the transition from commensal to pathogenic lifestyles

  • Therapeutic translation:

    • Development of SaeS inhibitors targeting the highly conserved ATP-binding region of the CA domain

    • Exploration of linker peptide mimetics as novel antimicrobial strategies

    • Investigation of combination therapies targeting multiple two-component systems simultaneously

These research directions represent a balanced approach combining mechanistic understanding with translational potential, addressing the multiple facets of SaeS function in S. epidermidis pathogenesis.

How might comparative studies of SaeS across staphylococcal species inform evolutionary insights?

Comparative studies of SaeS across staphylococcal species offer valuable evolutionary insights through several research avenues:

  • Functional conservation and divergence analysis:

    • Systematic comparison of linker peptide sequences across staphylococcal species to identify conserved vs. variable residues

    • Cross-species complementation experiments to determine functional interchangeability of SaeS proteins

    • Evaluation of signal response profiles to determine species-specific adaptations in sensing mechanisms

  • Host adaptation signatures:

    • Correlation of SaeS sequence variations with preferred host species and niches

    • Analysis of selection pressures on different SaeS domains across host-specialized staphylococcal species

    • Investigation of how SaeS differences contribute to commensal vs. pathogenic lifestyles in different host environments

  • Evolutionary rate disparities:

    • Comparison of evolutionary rates between different SaeS domains to identify rapidly evolving regions

    • Assessment of whether the linker peptide evolves more rapidly than transmembrane or kinase domains

    • Determination if evolutionary rates correlate with pathogenicity or host range

  • Horizontal gene transfer influence:

    • Examination of whether recombination events affecting saeS genes occur at similar frequencies across staphylococcal species

    • Investigation if the epidemic population structure observed in S. epidermidis is mirrored in other staphylococcal species

    • Analysis of mobile genetic elements that may co-transfer with saeS variants

  • Ancestral sequence reconstruction:

    • Computational reconstruction of ancestral SaeS sequences to trace evolutionary trajectory

    • Experimental testing of reconstructed ancestral SaeS proteins to determine functional changes over evolutionary time

    • Modeling of selection events that shaped modern SaeS variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.