Recombinant Staphylococcus epidermidis Holin-like protein CidB (cidB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly indicate your requirement when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery times, please consult your local distributor.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing it according to your specification.
Synonyms
cidB; SERP2116; Holin-like protein CidB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
cidB
Target Protein Sequence
MNEYLQAVLMILLTIVLYYVSKKIQDKYNNPLLNPALIASIAIIIVLLVCGVSYKGYMKG GTWINHVLNATVVCLAYPLYQNKKKIKKYLTIIFTSVLTGVVLNFVLVFTTLKIFGYSKD TIVTLLPRSITAAVGIEVSQELGGTDTITVLFIITTGLIGSILGSMLLRMGGFKSSIARG LTYGNASHAFGTAKALELDIESGAFSSIGMILTAVISSVLIPVLILLFY
Uniprot No.

Target Background

Function
This protein enhances the activity of extracellular murein hydrolases, potentially by facilitating their export through hole formation. Its function is inhibited by the antiholin-like proteins LrgAB. In unstressed cells, LrgAB products likely inhibit the function of CidAB proteins. When a cell encounters stress, such as antibiotic exposure or other environmental factors, CidAB proteins may oligomerize within the bacterial cell membrane, creating lesions that disrupt the proton motive force. This disruption leads to a loss of cell viability. These lesions are also theorized to regulate subsequent cell lysis by either granting murein hydrolases access to the cell wall substrate or by altering the cell wall pH due to a change in membrane potential, potentially influencing their activity.
Database Links
Protein Families
CidB/LrgB family, CidB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Staphylococcus epidermidis Holin-like protein CidB?

CidB is a membrane-associated protein in Staphylococcus epidermidis that belongs to the Cid/Lrg regulatory system. This protein shares structural and functional similarities with bacteriophage-encoded holins, which are small proteins containing transmembrane domains that control cell membrane integrity. In S. epidermidis, CidB (GenBank: Q8CR39) is a 229-amino acid protein with predicted transmembrane domains and is encoded by the cidB gene within the cidAB operon . Based on knowledge from related systems, CidB likely functions in conjunction with CidA to regulate murein hydrolase activity, affecting processes like cell death, lysis, and biofilm development .

How does the Cid/Lrg system function in Staphylococcus species?

The Cid/Lrg system acts as a molecular control mechanism for bacterial cell death and lysis, functioning similarly to a programmed cell death system. Studies primarily conducted in S. aureus demonstrate that:

  • The cidAB operon encodes proteins that have a positive influence on extracellular murein hydrolase activity and increase sensitivity to antibiotic-induced killing .

  • The lrgAB operon encodes proteins that inhibit murein hydrolase activity and decrease sensitivity to antibiotic-induced killing, functioning in an antiholin-like manner .

  • These opposing functions create a regulatory system that balances cell death and lysis during biofilm development and stress responses .

The relationship between these two operons appears to create a molecular control system similar to the holin/antiholin systems found in bacteriophages, where CidA/CidB function as holins and LrgA/LrgB function as antiholins .

How do CidB and related proteins oligomerize in the bacterial membrane?

Research on related proteins like CidA in S. aureus provides insight into potential oligomerization mechanisms of CidB. Studies show that CidA forms high-molecular-mass complexes dependent on disulfide bonds between cysteine residues . This oligomerization process appears critical for function:

  • CidA and LrgA proteins form oligomeric structures within the membrane, similar to bacteriophage holins.

  • Disulfide bond formation between cysteine residues mediates this oligomerization.

  • Mutation of key cysteine residues affects the timing and extent of cell lysis, suggesting that oligomerization fine-tunes the protein's function .

For researchers studying CidB, examining potential oligomerization sites and investigating how oligomer formation affects protein function would be valuable. Techniques such as Blue Native PAGE, crosslinking studies, or fluorescence resonance energy transfer (FRET) could be employed to characterize oligomerization patterns in CidB .

How does the cidAB operon expression change during bacterial growth phases?

Research on S. aureus shows that cidAB expression follows a growth phase-dependent pattern distinct from lrgAB expression. The cidAB operon is maximally expressed during early exponential growth, while lrgAB expression peaks later in growth . This temporal regulation suggests coordinated control of cell death and lysis throughout the bacterial life cycle.

For researchers investigating CidB in S. epidermidis, quantitative RT-PCR analysis similar to methods described in the literature could be employed to track expression patterns during growth:

  • Extract RNA from bacteria at different growth phases (early, mid, late exponential, and stationary).

  • Use gene-specific primers (similar to cidB-R: 5′-CCCCTCGAGATAGAATAATAAAATTAGAACAGG-3′) for reverse transcription.

  • Perform qPCR with appropriate controls (such as gyrA) to quantify expression levels .

This temporal expression pattern provides insight into when CidB might be most active during bacterial growth and biofilm development.

What is the relationship between CidB and antibiotic tolerance in Staphylococcus species?

Studies in S. aureus demonstrate that mutations in the cid operon increase antibiotic tolerance, particularly to β-lactam antibiotics like penicillin . The mechanism appears to involve regulation of murein hydrolase activity, which affects cell wall integrity during antibiotic-induced stress.

Researchers investigating CidB should consider:

  • Creating cidB deletion mutants and complemented strains to test sensitivity to various antibiotic classes.

  • Measuring survival rates during antibiotic challenge using methods such as minimum inhibitory concentration (MIC) determination and time-kill assays.

  • Evaluating changes in cell wall integrity using transmission electron microscopy or fluorescent probes that detect membrane potential changes .

Understanding how CidB affects antibiotic tolerance could provide insights into bacterial persistence and potentially identify new targets for antimicrobial development.

What are the optimal methods for recombinant expression of CidB protein?

Based on successful approaches with related proteins, researchers investigating CidB should consider these methodologies:

  • Expression Vector Selection: For membrane proteins like CidB, specialized expression systems such as pET24b vectors with C-terminal His-tags have proven effective for related proteins .

  • Bacterial Host Selection: Use specialized strains optimized for membrane protein expression, such as E. coli C43, a derivative of BL21(DE3) that has been selected for improved membrane protein production .

  • Induction and Growth Conditions:

    • Culture bacteria at lower temperatures (16-25°C) after induction

    • Use lower concentrations of inducer (e.g., IPTG 0.1-0.5 mM)

    • Include membrane-stabilizing additives like glycerol in growth media

  • Protein Extraction and Purification:

    • Employ gentle detergents for membrane protein solubilization (DDM, LDAO)

    • Use affinity chromatography followed by size exclusion chromatography

    • Store purified protein in specialized buffers containing 50% glycerol to maintain stability

These approaches address the challenges of expressing and purifying membrane-associated proteins while maintaining their native structure and function.

How can researchers effectively study CidB localization and membrane topology?

Understanding the membrane topology and localization of CidB is crucial for elucidating its function. Based on approaches used for related proteins, researchers should consider:

  • Fluorescent Protein Fusion Approaches:

    • Generate N- and C-terminal GFP (or other fluorescent protein) fusions

    • Use fluorescence microscopy to visualize localization patterns within bacterial cells

    • Employ time-lapse imaging to track dynamic changes during growth or stress conditions

  • Membrane Fractionation Techniques:

    • Separate cytoplasmic, membrane, and extracellular fractions

    • Use Western blotting with domain-specific antibodies to determine orientation

    • Employ protease accessibility assays to map exposed regions

  • Cysteine Scanning Mutagenesis:

    • Introduce cysteine residues at various positions within the protein

    • Use thiol-specific labeling reagents to determine accessibility

    • Map membrane-spanning regions based on labeling patterns

These methodologies provide complementary approaches to determine the precise membrane topology of CidB, which is essential for understanding its mechanistic function.

How should researchers interpret phenotypic changes in cidB mutants?

When analyzing cidB mutant phenotypes, researchers should implement a comprehensive approach:

  • Growth Analysis:

    • Compare growth curves of wild-type, mutant, and complemented strains

    • Measure growth under various stress conditions (pH, temperature, osmotic stress)

    • Quantify lag phase, doubling time, and maximum optical density

  • Murein Hydrolase Activity Assays:

    • Conduct zymographic analysis using cell wall substrates

    • Quantify hydrolase activity in cellular and extracellular fractions

    • Compare activity patterns between wild-type, mutant, and complemented strains

  • Biofilm Development Analysis:

    • Measure biofilm formation using crystal violet staining

    • Examine biofilm architecture using confocal microscopy

    • Quantify live/dead cell distribution within biofilms

  • Antibiotic Sensitivity Testing:

    • Determine minimum inhibitory concentrations

    • Conduct time-kill assays with various antibiotics

    • Measure survival rates in stationary phase cultures

Careful attention to experimental controls, including complementation studies to verify phenotypes are due to cidB mutation rather than polar effects, is essential for accurate interpretation.

What statistical approaches are most appropriate for analyzing CidB-related experimental data?

When analyzing experimental data related to CidB function, researchers should consider these statistical approaches:

  • For Quantitative Analysis of Gene Expression:

    • Normalize RT-PCR data to multiple reference genes

    • Apply ΔΔCt method for relative quantification

    • Use non-parametric tests when assumptions of normality cannot be met

  • For Phenotypic Comparisons:

    • Employ one-way ANOVA with appropriate post-hoc tests for multiple comparisons

    • Use repeated measures ANOVA for time-course experiments

    • Consider mixed effects models when analyzing complex experimental designs

  • For Biofilm Analysis:

    • Apply image analysis algorithms to quantify structural parameters

    • Use multivariate approaches to account for multiple parameters

    • Consider spatial statistics for analyzing distribution patterns

  • Sample Size Determination:

    • Conduct power analysis to determine appropriate sample sizes

    • Report effect sizes alongside p-values

    • Consider biological versus technical replication in experimental design

These approaches ensure robust analysis of complex data generated in CidB research, allowing for more reliable interpretation of results.

How might understanding CidB function contribute to addressing antibiotic resistance?

The holin-like function of CidB and its role in cell death and lysis suggest several potential applications in combating antibiotic resistance:

  • Novel Antimicrobial Targets:

    • Targeting CidB or its regulatory pathways might sensitize bacteria to existing antibiotics

    • Compounds that enhance CidB activity could potentially increase bacterial susceptibility to cell wall-active antibiotics

  • Biofilm Eradication Strategies:

    • Manipulating CidB function might disrupt biofilm formation or stability

    • Targeting the Cid/Lrg system could potentially enhance penetration of antibiotics into biofilms

  • Combination Therapy Approaches:

    • Understanding how CidB affects cell death pathways might inform optimal antibiotic combinations

    • Timing treatment to coincide with maximal cidB expression could enhance efficacy

Future research should focus on validating these potential applications through in vitro and in vivo models of infection.

What are the most promising directions for future CidB research?

Based on current understanding of CidB and related proteins, these research directions hold particular promise:

  • Structural Biology Approaches:

    • Determine high-resolution structures of CidB alone and in complex with interaction partners

    • Elucidate the mechanism of membrane pore formation

    • Investigate conformational changes associated with activation

  • Systems Biology Integration:

    • Map the complete regulatory network controlling cidB expression

    • Identify environmental signals that modulate the Cid/Lrg system

    • Develop predictive models of how the system responds to antibiotic stress

  • Comparative Analysis Across Species:

    • Characterize CidB homologs in diverse bacterial species

    • Identify species-specific adaptations in function

    • Explore evolutionary relationships between bacterial and phage holin systems

  • Translational Applications:

    • Develop screening methods for compounds that modulate CidB activity

    • Investigate potential as a target for anti-biofilm strategies

    • Explore applications in controlled bacterial lysis for biotechnology

These directions build upon current knowledge while addressing key gaps in understanding CidB function and potential applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.