Recombinant Staphylococcus epidermidis Membrane protein insertase YidC 2 (yidC2)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC2 and Its Biological Role

YidC2 is a membrane protein insertase belonging to the conserved YidC/Oxa1/Alb3 family, which facilitates the insertion and folding of membrane proteins in bacteria. While extensive studies have focused on YidC homologs in Escherichia coli, Bacillus subtilis, and Streptococcus mutans, its role in S. epidermidis remains understudied. In other organisms, YidC2 operates in concert with the SecYEG translocon or independently to integrate hydrophobic transmembrane segments (TMS) into lipid bilayers .

Key Functions:

  • Cotranslational insertion of single-pass and multipass membrane proteins.

  • Stabilization of nascent chains during ribosomal translation.

  • Coordination with stress-responsive pathways under adverse conditions .

Interaction Networks and Functional Partners

YidC2 interacts with ribosomal components and other insertases to coordinate membrane protein biogenesis. Known partners include:

PartnerRoleSource Organism
Ribosomal proteinsStabilization of nascent chains during translationS. mutans
SecY/SecE/SecGSynergy in Sec-dependent insertion pathwaysE. coli
YibNAugments substrate insertion efficiency, modulates lipid organizationE. coli
SRP pathway componentsCollaboration in stress-responsive insertionS. mutans

Note: In S. epidermidis, no direct interactors have been identified. The above table reflects findings from other species .

Regulatory Mechanisms

Regulation of YidC2 expression and activity varies across bacteria:

MechanismDescriptionSource Organism
Translational arrest sensorsMifM (in B. subtilis) monitors YidC1 activity; arrests yidC2 translation via mRNA hairpinsB. subtilis
Stress-induced expressionUpregulated under oxidative/osmotic stress to enhance membrane stabilityS. mutans
Chaperone-mediated foldingYibN (in E. coli) enhances substrate insertion efficiencyE. coli

In S. epidermidis, regulatory pathways remain uncharacterized. Analogous systems in B. subtilis suggest potential conservation of translational arrest mechanisms .

Role in Stress Tolerance

YidC2 homologs in S. mutans and B. subtilis are critical for maintaining membrane integrity under stress:

Stress ConditionYidC2 FunctionSource Organism
Acidic pHStabilizes membrane proteins involved in pH homeostasisS. mutans
Oxidative damageFacilitates repair of membrane proteins damaged by reactive oxygen speciesS. mutans
High osmolarityModulates membrane lipid composition to counteract osmotic imbalanceB. subtilis

Note: S. epidermidis yidC2’s role in stress responses is inferred from orthologs but not experimentally validated .

Comparative Analysis with YidC1

YidC1 and YidC2 exhibit functional divergence, particularly in stress adaptation:

FeatureYidC1YidC2
Primary FunctionGeneral membrane protein insertionStress-responsive insertion
Pathway PreferenceSecYEG-dependentSRP-dependent
Stress ToleranceMinimal roleEnhanced under stress conditions
Substrate SpecificityBroad range of substratesStress-related membrane proteins

This distinction is well-documented in S. mutans but unexplored in S. epidermidis .

Research Gaps and Future Directions

  1. Structural Characterization: No cryo-EM or X-ray crystallography data exist for S. epidermidis YidC2.

  2. Interaction Networks: Partners such as YibN or SRP components remain unverified.

  3. Regulatory Mechanisms: Translational arrest sensors (e.g., MifM analogs) are unknown.

  4. Pathogenic Relevance: Potential links to biofilm formation or antibiotic resistance in S. epidermidis require investigation.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
yidC2; SERP1697; Membrane protein insertase YidC 2; Foldase YidC 2; Membrane integrase YidC 2; Membrane protein YidC 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-290
Protein Length
Full Length of Mature Protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
yidC2
Target Protein Sequence
CDYSTPEKQDGFFFNTFVQPMKHLLQWLGNDVFHNNFGLAIIVLVLFIRLILLPFMLSNY KNSHMMREKMKVAKPEVDGIQEKVKRARTQEEKMAANQELMEVYKKYDMNPMKSMLGCLP ILIQMPIIMGLYFVLKDKLVNGLSEHPHFLWFNLTKPDIWITVIAGVLYFIQAVVSSKTM PQEQRQMGYMMMVISPIMIIWISLQASSALGLYWSVSALFLVIQTHFANIYYSKLAKKEV QPFIEKYEREHNPSSKKKGKNTQVVSKKNKK
Uniprot No.

Target Background

Function
This protein is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It participates in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as in the integration of at least some lipoproteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 2 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of YidC2 in Staphylococcus epidermidis?

YidC2 in S. epidermidis functions as a membrane protein insertase that facilitates the integration of nascent membrane proteins. It can work either dependently or independently from the Sec-translocase pathway. YidC2 acts as a protein insertase, facilitates proper protein folding, ensures correct topology, and serves as an assembly factor for transmembrane proteins . In the context of S. epidermidis, which is known for its biofilm formation and role in device-associated infections , YidC2 likely plays a crucial role in maintaining membrane integrity and function.

As demonstrated in studies with other Gram-positive bacteria, YidC2 often serves as a secondary membrane protein insertase that can be upregulated when the primary insertase (YidC1) is limited or absent . This functional redundancy suggests an important role in bacterial survival under stress conditions.

How does YidC2 differ structurally from YidC1?

While both YidC1 and YidC2 belong to the same protein family, they exhibit distinct structural features that contribute to their functional differences. The YidC2 protein in S. epidermidis contains domains that interact with components of the SRP (Signal Recognition Particle) pathway . Based on studies in Streptococcus mutans, YidC2 appears to have stronger interactions with SRP pathway components (Ffh and FtsY), while YidC1 shows stronger interactions with components of the Sec translocon .

The recombinant S. epidermidis YidC2 protein consists of 278 amino acids with a sequence that includes several transmembrane domains and cytoplasmic regions that mediate interactions with other proteins . The C-terminal region is particularly important for these protein-protein interactions, as evidenced by C-terminal tail capture experiments in related species .

What methods are used to produce recombinant S. epidermidis YidC2 for research?

Production of recombinant S. epidermidis YidC2 typically involves:

  • Gene cloning: The yidC2 gene from S. epidermidis (often strain ATCC 12228) is amplified and cloned into an expression vector.

  • Expression system selection: Due to the membrane protein nature of YidC2, specialized expression systems that can handle membrane proteins are often used, such as E. coli strains designed for membrane protein expression.

  • Protein expression optimization: Parameters including temperature, induction time, and inducer concentration must be optimized to ensure proper folding and prevent inclusion body formation.

  • Protein purification: This typically involves:

    • Cell disruption

    • Membrane fraction isolation

    • Detergent solubilization of membrane proteins

    • Affinity chromatography using tags (His-tag is common)

    • Size exclusion chromatography for further purification

  • Quality control: Assessing purity by SDS-PAGE and confirming identity through Western blotting or mass spectrometry .

The recombinant protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability, and aliquoted to avoid repeated freeze-thaw cycles that could compromise protein integrity .

How can researchers experimentally determine the interactome of YidC2 in S. epidermidis?

Based on methodologies used with related organisms, researchers can employ multiple complementary approaches to map the YidC2 interactome:

  • Chemical cross-linking coupled with mass spectrometry (MS):

    • Treat S. epidermidis cells with formaldehyde to cross-link interacting proteins

    • Lyse cells and perform immunoprecipitation with anti-YidC2 antibodies

    • Identify co-captured proteins by MS analysis

  • Immunoprecipitation with antibody-coupled magnetic beads:

    • Cross-link S. epidermidis lysates

    • React with anti-YidC2-coupled Dynabeads

    • Identify co-captured proteins by MS analysis

  • C-terminal tail capture experiments:

    • Express the C-terminal domain of YidC2 as a bait

    • Capture interacting proteins

    • Perform two-dimensional difference gel electrophoresis

    • Identify interacting proteins by MS analysis

  • Bacterial two-hybrid assay:

    • Use to confirm direct interactions between YidC2 and putative binding partners

    • This method helps distinguish direct interactions from indirect ones in complex protein assemblies

  • Western blot analysis of cross-linked complexes:

    • React cross-linked lysates with specific antibodies

    • Analyze gel-shifted bands by MS to identify components of protein complexes

Using such methods with S. mutans, researchers have identified interactions between YidC proteins and components of the SRP pathway (Ffh, FtsY), chaperones (DnaK, RopA), and potential membrane-localized substrates .

What is the regulatory mechanism controlling YidC2 expression in Gram-positive bacteria, and how might this apply to S. epidermidis?

In Bacillus subtilis, YidC2 expression is regulated by a sophisticated translational control mechanism involving the MifM protein:

  • MifM sensor system:

    • The MifM protein contains an N-terminal transmembrane domain that is inserted into the membrane by YidC1/SpoIIIJ

    • When YidC1 activity is limited, MifM insertion is inhibited

    • This triggers translational arrest of the MifM nascent chain due to interaction between the MifM C-terminus and the ribosomal exit tunnel

  • Translational coupling mechanism:

    • The arrested ribosome unfolds an mRNA hairpin structure that normally blocks the YidC2 Shine-Dalgarno sequence

    • This allows translation initiation of YidC2

    • When membrane insertion capacity is restored, translational arrest is relieved, allowing the hairpin to refold and block YidC2 translation

While this specific mechanism has been characterized in B. subtilis, similar translational control mechanisms might exist in S. epidermidis. Research to determine if S. epidermidis possesses a MifM-like sensor or an alternative regulatory mechanism would provide valuable insights into stress responses and adaptation mechanisms in this clinically important pathogen.

How does inhibition of YidC2 impact S. epidermidis virulence and biofilm formation?

Research suggests that YidC2 inhibition may significantly impact S. epidermidis virulence properties:

Understanding these relationships could lead to novel therapeutic approaches targeting YidC2 function to combat S. epidermidis infections, particularly in biofilm-associated device infections that are notoriously difficult to treat with conventional antibiotics.

What methodological approaches can be used to study the structure-function relationship of YidC2 in S. epidermidis?

To investigate the structure-function relationship of YidC2, researchers can employ:

  • Site-directed mutagenesis:

    • Introduce specific mutations in conserved residues or domains

    • Express and purify mutant proteins

    • Compare functional properties with wild-type YidC2

    • This approach helps identify key residues for substrate binding, catalytic activity, or interaction with other proteins

  • Domain deletion and chimeric protein construction:

    • Create truncated versions of YidC2 lacking specific domains

    • Generate chimeric proteins by swapping domains between YidC1 and YidC2

    • These constructs help determine domain-specific functions and explain functional differences between paralogs

  • Cryo-electron microscopy:

    • For high-resolution structural analysis of YidC2 alone or in complex with substrate proteins

    • This approach reveals conformational changes during the membrane insertion process

  • In vitro reconstitution assays:

    • Reconstitute purified YidC2 into liposomes

    • Use these proteoliposomes to study membrane protein insertion directly

    • Measure insertion efficiency with fluorescently labeled substrate proteins

  • Molecular dynamics simulations:

    • Complement experimental approaches with computational modeling

    • Predict how mutations might affect protein structure and function

    • Simulate interactions between YidC2 and substrate proteins

These complementary approaches would provide a comprehensive understanding of how YidC2 structure relates to its function in S. epidermidis membrane protein biogenesis.

How can researchers distinguish between YidC1 and YidC2 substrate specificity in S. epidermidis?

Determining substrate specificity differences between YidC1 and YidC2 in S. epidermidis requires multifaceted approaches:

  • Comparative proteomics of deletion mutants:

    • Generate ΔyidC1 and ΔyidC2 mutant strains

    • Compare membrane proteome compositions using quantitative proteomics

    • Proteins significantly reduced in one mutant but not the other may represent specific substrates

  • Complementation studies:

    • Express YidC1 or YidC2 in deletion mutants under controlled conditions

    • Assess which proteins are restored in the membrane fraction

    • This helps confirm substrate specificity suggested by proteomics

  • In vitro membrane insertion assays:

    • Purify recombinant YidC1 and YidC2

    • Reconstitute each protein into separate proteoliposome systems

    • Test insertion efficiency of candidate substrate proteins

  • Bacterial two-hybrid screening:

    • Use YidC1 or YidC2 as bait proteins

    • Screen against a library of S. epidermidis membrane proteins

    • Identify direct interaction partners specific to each YidC paralog

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.