Recombinant Staphylococcus epidermidis Monofunctional glycosyltransferase (mgt)

Shipped with Ice Packs
In Stock

Description

Function and Role of Monofunctional Glycosyltransferase

In Staphylococcus aureus, the monofunctional glycosyltransferase (MGT) is known to catalyze the incorporation of UDP-N-acetylglucosamine into peptidoglycan, which is a crucial component of the bacterial cell wall . This enzyme shares homology with glycosyltransferases from gram-negative bacteria and the N-terminal domain of class A high-molecular-mass penicillin-binding proteins . While specific data on Staphylococcus epidermidis MGT is limited, its role in peptidoglycan synthesis would be analogous to that in S. aureus.

Comparison with Other Glycosyltransferases in Staphylococci

Other glycosyltransferases in Staphylococcus species, such as TagE in S. epidermidis, are involved in modifying wall teichoic acids (WTAs) with glucose, affecting phage susceptibility . In contrast, TarM(Se) in S. epidermidis glycosylates ribitol phosphate WTAs with glucose, aiding in immune evasion . These enzymes highlight the diversity of glycosylation patterns and their impact on bacterial interactions with phages and the host immune system.

Research Findings and Implications

While specific research on recombinant Staphylococcus epidermidis MGT is limited, studies on similar enzymes in S. aureus and other glycosyltransferases in S. epidermidis provide insights into their potential roles:

  • Peptidoglycan Synthesis: MGTs are crucial for peptidoglycan biosynthesis, which is essential for bacterial cell wall integrity.

  • Glycosylation Patterns: Different glycosyltransferases modify cell wall components like WTAs, influencing phage binding and immune evasion.

  • Therapeutic Potential: Understanding these enzymes can aid in developing targeted therapies against staphylococcal infections.

Data Tables

Given the limited specific data on Staphylococcus epidermidis MGT, we can summarize general findings related to glycosyltransferases in staphylococci:

EnzymeOrganismFunctionSubstrate
MGTS. aureusPeptidoglycan synthesisUDP-N-acetylglucosamine
TagES. epidermidisGlucose modification of WTAUDP-glucose
TarM(Se)S. epidermidisGlucose modification of RboP-WTAUDP-glucose

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: If you require a specific tag type, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
mgt; SERP1412; Monofunctional glycosyltransferase; MGT; Peptidoglycan TGase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
mgt
Target Protein Sequence
MKRSDKYTDDYIEQRYESQRPHYNTYYQPIGKPPKKKKSKRIFLKAIITILILLIIFFGV MYFISSRANVDDLKSIENKSDFVATENMPNYVKGAFISMEDERFYKHHGFDIKGTTRALF STISDRDVQGGSTITQQVVKNYYYDNERSFTRKIKELFVARKVEKQYSKNQILSFYMNNI YYGDNQYTVEGAANHYFGVTVDKNNSNMSQISVLQSAILASKVNAPSVYDVNDMSNNYIN RVKTNLEKMKQQNFISESQYQEAMSQLGN
Uniprot No.

Target Background

Function
Recombinant *Staphylococcus epidermidis* Monofunctional glycosyltransferase (mgt) is a peptidoglycan polymerase that catalyzes glycan chain elongation using lipid-linked disaccharide-pentapeptide as a substrate.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is S. epidermidis Monofunctional glycosyltransferase (MGT) and what is its significance in bacterial physiology?

Monofunctional glycosyltransferase (MGT) from S. epidermidis is an enzyme involved in bacterial cell wall biosynthesis. Unlike bifunctional penicillin-binding proteins, MGT specifically catalyzes the glycosyltransferase reaction without performing transpeptidase activities. The enzyme transfers glycosyl moieties from donor substrates to acceptor molecules in the peptidoglycan synthesis pathway. MGT plays a critical role in maintaining cell wall integrity in S. epidermidis, which is significant given this organism's dual lifestyle as both a commensal skin bacterium and an opportunistic pathogen . The enzyme shares significant homology with MGTs from gram-negative bacteria and the N-terminal glycosyltransferase domain of class A high-molecular-mass penicillin-binding proteins from various species . Understanding MGT function provides insight into bacterial survival mechanisms and potential antimicrobial targets.

How does S. epidermidis MGT compare structurally and functionally to MGTs from other bacterial species?

S. epidermidis MGT shares considerable structural and functional similarities with other Staphylococcal MGTs, particularly that of S. aureus. Both enzymes contain an N-terminal hydrophobic domain involved in membrane association, which is a common feature among bacterial MGTs . The catalytic domain demonstrates high conservation across species, reflecting the enzyme's fundamental role in peptidoglycan synthesis.

What expression systems and strategies are most effective for recombinant S. epidermidis MGT production?

E. coli expression systems have proven effective for recombinant S. epidermidis MGT production, particularly when expressing the protein with affinity tags such as an N-terminal His-tag . Based on experiences with similar enzymes, the following methodological approaches are recommended:

  • Construct design considerations: Expressing MGT as a truncated protein lacking the N-terminal hydrophobic domain significantly improves solubility while maintaining enzymatic activity . This approach was successfully applied to S. aureus MGT and is transferable to S. epidermidis MGT.

  • Vector selection: pET-based expression vectors under T7 promoter control provide high-level expression for detailed biochemical studies.

  • Host strain optimization: E. coli BL21(DE3) or its derivatives are preferred host strains due to their reduced protease activity and compatibility with T7 expression systems .

  • Expression conditions: Induction at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) often enhances soluble protein yield for membrane-associated enzymes like MGT .

  • Co-expression strategies: Co-expression with molecular chaperones can significantly increase the soluble:insoluble ratio of recombinant glycosyltransferases in heterologous expression systems .

What purification approaches yield the highest purity and activity for recombinant S. epidermidis MGT?

A multi-step purification strategy is recommended to obtain high-purity, enzymatically active S. epidermidis MGT:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged proteins allows efficient initial purification . Optimize imidazole concentrations in wash buffers (20-40 mM) to minimize non-specific binding while preventing target protein elution.

  • Buffer optimization: Including glycerol (10-15%) and reducing agents (1-5 mM DTT or β-mercaptoethanol) in lysis and purification buffers enhances enzyme stability .

  • Secondary purification: Size exclusion chromatography effectively removes aggregates and improves homogeneity of the preparation.

  • Activity preservation: Incorporate UDP-N-acetylglucosamine (0.1-0.5 mM) in storage buffers to stabilize the enzyme's active site.

  • Storage considerations: Flash-freeze purified enzyme in liquid nitrogen and store at -80°C in small aliquots to maintain activity through multiple freeze-thaw cycles.

This approach has been successfully applied to S. aureus MGT and can be adapted for S. epidermidis MGT with modifications based on specific protein characteristics .

What assays are recommended for measuring S. epidermidis MGT enzymatic activity?

Several complementary approaches can be employed to assess S. epidermidis MGT activity:

  • Phosphatase-coupled glycosyltransferase assay: This method measures the release of nucleoside diphosphate during glycosyl transfer using phosphatases and malachite green detection. The approach allows quantitative measurement of enzyme kinetics and is suitable for high-throughput screening .

Assay ComponentConcentrationFunction
MGT enzyme0.1-5 μg/mLCatalyzes glycosyl transfer
UDP-N-acetylglucosamine0.1-1 mMGlycosyl donor
Peptidoglycan fragments0.5-2 mMAcceptor substrate
Phosphatase (e.g., CD39L3)1-10 μg/mLReleases free phosphate from UDP
MgCl₂5-10 mMCofactor
Buffer (HEPES, pH 7.5)50 mMMaintains optimal pH
  • Radiolabeled substrate incorporation: Using ¹⁴C or ³H-labeled UDP-N-acetylglucosamine to track incorporation into peptidoglycan provides a sensitive measure of MGT activity.

  • HPLC/MS analysis: Product formation can be monitored by chromatographic separation and mass spectrometric detection of peptidoglycan structures.

  • Lysozyme sensitivity assay: The reaction products of active MGT should be sensitive to lysozyme treatment, providing a functional confirmation of proper glycan strand formation .

How can structural studies enhance our understanding of S. epidermidis MGT function?

Structural characterization of S. epidermidis MGT provides critical insights into its catalytic mechanism and potential for inhibitor development:

  • Circular dichroism (CD) spectroscopy: CD analysis reveals secondary structural elements and can confirm proper protein folding. For S. aureus MGT, CD analysis verified that the purified truncated protein maintained the expected structural elements, suggesting proper folding . Similar approaches can be applied to S. epidermidis MGT.

  • X-ray crystallography: Determining the three-dimensional structure of S. epidermidis MGT in complex with substrates or inhibitors provides atomic-level insights into catalytic mechanisms.

  • Molecular dynamics simulations: Computational approaches can model enzyme flexibility and substrate interactions based on homology models or crystal structures.

  • HDX-MS (Hydrogen-deuterium exchange mass spectrometry): This technique can identify regions of conformational dynamics important for catalysis and substrate binding.

  • Site-directed mutagenesis: Systematic mutation of conserved residues coupled with activity assays can validate structural predictions about catalytic mechanisms.

These structural studies should be designed to specifically investigate the catalytic domain and potential membrane interaction regions of the enzyme .

How can computational approaches be used to enhance S. epidermidis MGT properties for research applications?

Computational design strategies can significantly improve S. epidermidis MGT properties, particularly thermostability and catalytic efficiency:

  • Stabilizing mutation scanning: This approach identifies potential stabilizing mutations by computational analysis of protein structure. When applied to the glycosyltransferase UGT76G1, this method led to variants with up to 9°C increases in apparent melting temperature (Tm) .

  • Rosetta-based protein design: This computational protocol has been effective for glycosyltransferases like UGT76G1, resulting in variants with 1.91-2.55-fold increases in catalytic capacity . The method could be adapted for S. epidermidis MGT by:

    • Building a reliable homology model based on related bacterial MGTs

    • Performing in silico mutagenesis to identify stabilizing mutations

    • Designing combinatorial libraries focusing on active site residues

  • Molecular dynamics simulations: These can identify flexible regions that might benefit from stabilization. Analysis of protein dynamics at elevated temperatures can suggest mutations to enhance thermostability.

  • Machine learning approaches: Training models on existing glycosyltransferase data can predict mutations likely to improve specific properties like solubility or substrate specificity.

For S. epidermidis MGT, focus should be placed on enhancing solubility and reducing membrane dependency while maintaining catalytic function .

What is the significance of S. epidermidis MGT in biofilm formation and potential antimicrobial strategies?

S. epidermidis MGT plays a complex role in biofilm formation and represents a potential antimicrobial target:

  • Contribution to biofilm matrix: As a cell wall biosynthesis enzyme, MGT influences peptidoglycan structure, which can affect biofilm matrix composition and integrity. S. epidermidis is a canonical opportunistic biofilm former and the most common cause of implant-associated infections .

  • Strain-specific variations: High strain-level heterogeneity in S. epidermidis may result in MGT variants with different activities, potentially contributing to varying biofilm formation capabilities across clinical isolates .

  • Antimicrobial targeting strategies:

    • Enzyme inhibition: Moenomycin A inhibits MGT activity and could serve as a structural template for developing selective inhibitors .

    • Combination approaches: MGT inhibitors could potentially sensitize biofilm bacteria to conventional antibiotics by weakening cell wall integrity.

    • Biofilm dispersal: Targeting MGT might disrupt established biofilms by interfering with cell wall maintenance.

  • Host-microbe interaction: Understanding how MGT activity influences S. epidermidis interactions with host immune cells could lead to immunomodulatory approaches for managing infections .

Research methodologies should include biofilm formation assays under MGT inhibition or in MGT mutant strains, confocal microscopy to assess biofilm architecture changes, and animal infection models to evaluate in vivo relevance.

What methodological approaches are recommended for studying the role of MGT in S. epidermidis pathogenicity?

To investigate MGT's role in S. epidermidis pathogenicity, the following methodological approaches are recommended:

  • Genetic manipulation strategies:

    • CRISPR-Cas9 gene editing to create MGT knockout or point mutants

    • Controlled expression systems (inducible promoters) to modulate MGT levels

    • Complementation studies to confirm phenotypes are specifically due to MGT

  • Infection models:

    • In vitro cell culture models using relevant human cell types (keratinocytes, fibroblasts)

    • Catheter-associated infection models to study biofilm formation

    • Animal models mimicking implant-associated infections

  • Comparative genomics and transcriptomics:

    • Analysis of MGT sequence variation across clinical isolates with different virulence profiles

    • Transcriptomic studies to determine MGT expression patterns during infection

  • Peptidoglycan analysis:

    • HPLC and mass spectrometry to characterize changes in peptidoglycan structure

    • Fluorescent D-amino acid labeling to visualize cell wall synthesis dynamics

  • Host response characterization:

    • Measurements of innate immune activation by wildtype versus MGT-modified strains

    • Assessment of MAIT cell activation, which is relevant for S. epidermidis interactions with the host immune system

These approaches should be designed to distinguish MGT's direct contributions to pathogenicity from indirect effects due to altered bacterial fitness or stress responses.

How can researchers overcome common challenges in recombinant S. epidermidis MGT expression and purification?

Researchers frequently encounter several challenges when working with recombinant S. epidermidis MGT. The following methodological solutions address these issues:

  • Poor solubility:

    • Optimize N-terminal truncation sites to remove the hydrophobic domain while preserving enzyme activity

    • Screen multiple fusion tags beyond His-tag (MBP, SUMO, TRX) to enhance solubility

    • Implement a high-throughput screening approach to test multiple construct designs simultaneously

  • Low expression levels:

    • Test codon optimization for E. coli expression

    • Evaluate different promoter systems (T7, tac, ara)

    • Explore alternate host strains (C41/C43 for membrane proteins)

  • Protein instability:

    • Incorporate stabilizing additives in buffers (glycerol, specific ions, reducing agents)

    • Implement the computational stabilization approaches described in section 4.1

    • Consider co-expression with chaperones, which has been shown to increase soluble:insoluble ratios for glycosyltransferases

  • Purification challenges:

    • Optimize lysis conditions to effectively release membrane-associated MGT

    • Implement stepwise imidazole gradients during IMAC purification

    • Consider detergent screening if membrane association remains problematic

The high-throughput pipeline approach described for plant cell wall glycosyltransferases can be adapted for S. epidermidis MGT, enabling rapid screening of multiple expression and purification conditions .

What methodological approaches can be used to study enzyme kinetics of S. epidermidis MGT?

Detailed kinetic analysis of S. epidermidis MGT requires carefully designed experimental approaches:

  • Initial rate determination:

    • Use the phosphatase-coupled assay described in section 3.1 to measure initial rates across a range of substrate concentrations

    • Ensure measurements are taken within the linear range of both MGT and the coupled phosphatase reaction

  • Kinetic parameter calculation:

    • Determine Km and Vmax for UDP-N-acetylglucosamine using Michaelis-Menten or Lineweaver-Burk plots

    • Calculate catalytic efficiency (kcat/Km) to compare with other glycosyltransferases

  • Inhibition studies:

    • Determine IC50 and Ki values for moenomycin A and other potential inhibitors

    • Characterize inhibition mechanisms (competitive, non-competitive, uncompetitive) using appropriate plots

  • pH and temperature profiles:

    • Measure activity across pH ranges (5.0-9.0) and temperatures (20-60°C) to determine optimal conditions

    • Calculate activation energy (Ea) using Arrhenius plots

  • Metal ion dependency:

    • Screen various divalent cations (Mg²⁺, Mn²⁺, Ca²⁺) to identify cofactor requirements

    • Determine optimal concentrations for activity

The following sample experiment design table provides a framework for comprehensive kinetic analysis:

ParameterRange to TestMeasurement MethodExpected Outcome
UDP-GlcNAc Km10 μM - 2 mMPhosphatase-coupled assay100-500 μM based on similar MGTs
pH optimumpH 5.0-9.0Activity at fixed substratepH 7.0-7.5 expected optimum
Temperature stability4-60°CResidual activity after incubationStability profile for storage recommendations
Moenomycin A inhibition0.1-100 μMIC50 determinationExpected IC50 5-20 μM

This methodological framework provides a comprehensive approach to characterizing the kinetic properties of S. epidermidis MGT, critical information for both basic understanding and inhibitor development.

What emerging techniques could advance our understanding of S. epidermidis MGT function in vivo?

Several cutting-edge methodological approaches show promise for investigating S. epidermidis MGT function in physiologically relevant contexts:

  • Cryo-electron tomography: This technique allows visualization of MGT within the native cellular environment, providing insights into its spatial organization and interactions with other cell wall synthesis machinery.

  • Chemical biology approaches: Development of activity-based probes specific for MGT would enable tracking of its activity in living cells under various conditions.

  • Single-molecule studies: Techniques like FRET or optical tweezers could reveal the dynamics of MGT interactions with substrates and the processivity of glycan strand synthesis.

  • In situ mutagenesis: CRISPR interference (CRISPRi) or inducible degradation systems would allow temporal control of MGT function to study its role during different growth phases or infection stages.

  • Microfluidic systems: These could enable real-time observation of S. epidermidis biofilm formation and the effects of MGT inhibition under controlled flow conditions that mimic implant surfaces.

These advanced methodologies would complement existing biochemical and genetic approaches to provide a more comprehensive understanding of MGT's role in S. epidermidis physiology and pathogenicity .

How might insights from S. epidermidis MGT research translate to understanding other glycosyltransferases in diverse biological systems?

Research on S. epidermidis MGT provides valuable insights with broader implications for glycosyltransferase biology across different systems:

  • Evolutionary conservation: Comparative analysis of bacterial MGTs reveals conserved catalytic mechanisms that may extend to eukaryotic glycosyltransferases, despite limited sequence homology .

  • Structural biology platforms: Methods developed for expression and crystallization of bacterial MGTs can be adapted for other challenging membrane-associated glycosyltransferases .

  • Enzyme engineering principles: Computational approaches that successfully enhance MGT stability and activity could be transferred to other glycosyltransferases, including those with industrial applications like UGT76G1 from Stevia rebaudiana .

  • Assay development: The phosphatase-coupled glycosyltransferase assay represents a versatile platform adaptable to diverse glycosyltransferases beyond bacterial systems .

  • Host-microbe interaction paradigms: Understanding how MGT activity influences S. epidermidis interactions with human immune cells may reveal general principles about how glycan structures modulate immune recognition across various host-microbe interfaces .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.