Recombinant Staphylococcus epidermidis Na (+)/H (+) antiporter subunit C1 (mnhC1)

Shipped with Ice Packs
In Stock

Description

Staphylococcus epidermidis: Commensal and Opportunistic Pathogen

Staphylococcus epidermidis is a Gram-positive bacterium that forms an integral part of the human skin microbiota. This species plays a dual role in human health, functioning both as a beneficial commensal organism and as an opportunistic pathogen. As a key member of the healthy skin microbiota, S. epidermidis contributes to defense mechanisms against pathogens and modulates immune responses . Its ubiquitous presence on human skin makes it one of the most abundant colonizers of this ecosystem.

Despite its beneficial role, S. epidermidis is frequently implicated in human infections associated with indwelling medical devices due to its ability to form robust biofilms . These biofilm-associated infections are particularly challenging to treat as they provide protection against both antimicrobial agents and host immune defenses. The formation of a robust biofilm represents the primary mechanism through which S. epidermidis causes infections on medical implants . Recent research has also identified differences between S. epidermidis strains isolated from healthy skin versus those from diseased conditions, with strains from atopic lesional skin shown to alter epidermis structure in laboratory models .

Importance of Ion Transport in Bacterial Physiology

Ion transport systems, particularly Na(+)/H(+) antiporters, play fundamental roles in bacterial physiology by maintaining ionic homeostasis and regulating intracellular pH. These membrane proteins facilitate the exchange of sodium ions (Na+) and protons (H+) across cellular membranes, a process critical for bacterial survival in various environmental conditions.

Genetic Organization and Expression

The mnhC1 gene in Staphylococcus epidermidis is designated with the ordered locus name SE_0644 in the genome of the reference strain ATCC 12228 . This gene encodes the Na(+)/H(+) antiporter subunit C1, which is also known by its alternative name, Mnh complex subunit C1. The gene is part of a larger operon that encodes multiple components of the Mnh complex, a multisubunit system responsible for cation/proton antiporter activity.

The expression of mnhC1 is likely regulated in response to environmental conditions, particularly changes in pH and sodium concentration, though specific regulatory mechanisms are not explicitly detailed in the available literature. As with many membrane transport proteins, expression may be modulated according to cellular needs for ion homeostasis and pH adaptation.

Role in Ion Homeostasis and pH Regulation

As a component of the Mnh complex, mnhC1 contributes to the maintenance of sodium and proton gradients across the bacterial membrane. This function is essential for pH homeostasis, allowing S. epidermidis to survive in environments with varying pH levels, including the human skin which typically has an acidic pH.

The Na(+)/H(+) antiporter activity involves the exchange of sodium ions for protons across the cell membrane, a process that can either acidify or alkalinize the cytoplasm depending on the direction of ion movement. This mechanism enables the bacterium to respond to changes in environmental pH and maintain optimal intracellular conditions for metabolic processes and protein function.

Potential Role in Virulence and Biofilm Formation

While direct evidence linking mnhC1 specifically to virulence mechanisms is limited in the available literature, the broader context of ion transport systems in staphylococcal species suggests potential contributions to pathogenicity. In S. epidermidis, the formation of biofilms represents a primary virulence mechanism, particularly in infections associated with medical implants .

Ion homeostasis is critical for bacterial adaptation to host environments and may influence the expression of virulence factors. For example, changes in pH and ion concentrations can affect the expression of genes involved in biofilm formation. The accessory gene regulator (agr) quorum sensing system, which plays a prominent role in biofilm establishment and infection by S. epidermidis, is sensitive to environmental conditions that may be influenced by ion transport systems .

Furthermore, the ability of S. epidermidis to persist in various host environments may depend on functional ion transport systems that enable adaptation to changing conditions. This adaptability contributes to the bacterium's success both as a commensal organism and as an opportunistic pathogen.

Research Applications

Recombinant mnhC1 protein serves as a valuable tool for various research applications focused on understanding bacterial physiology, membrane transport mechanisms, and potential therapeutic targets. These applications include:

  1. Structural Studies: Purified recombinant protein enables detailed structural analysis using techniques such as X-ray crystallography, nuclear magnetic resonance spectroscopy, or cryo-electron microscopy. These studies can reveal the three-dimensional architecture of the protein and provide insights into its mechanism of action.

  2. Functional Assays: Recombinant mnhC1 can be incorporated into liposomes or other membrane systems to study its ion transport activity under controlled conditions. Such assays help define the kinetics and specificity of ion exchange mediated by the protein.

  3. Antibody Production: The recombinant protein serves as an antigen for generating specific antibodies that can be used in techniques such as immunoblotting, immunoprecipitation, or immunohistochemistry to study the expression and localization of mnhC1 in bacterial cells.

  4. Drug Discovery: As a bacterial membrane protein, mnhC1 represents a potential target for novel antimicrobial agents. Recombinant protein enables screening of compound libraries to identify molecules that interact with and potentially inhibit its function.

  5. Comparative Studies: The availability of recombinant mnhC1 facilitates comparative studies with related proteins from other bacterial species, contributing to our understanding of evolutionary relationships and functional conservation among ion transport systems.

Comparison with Other Mnh Subunits

The mnhC1 protein represents one component of the multisubunit Mnh complex involved in Na(+)/H(+) antiporter activity in S. epidermidis. Other subunits of this complex include mnhB1, which likely works in concert with mnhC1 to facilitate ion transport across the bacterial membrane .

Table 3. Comparison between mnhC1 and mnhB1 Subunits

FeaturemnhC1mnhB1
FunctionNa(+)/H(+) antiporter subunit C1 Na(+)/H(+) antiporter subunit B1
Complex AssociationMnh complex subunit C1 Mnh complex subunit B1
Commercial AvailabilityAvailable as recombinant protein Available as recombinant protein
Approximate Market Price1,456.00 € $1,415.00

Comparison with Na(+)/H(+) Antiporters in Other Bacterial Species

Na(+)/H(+) antiporter systems are widespread among bacteria, reflecting the fundamental importance of ion homeostasis across diverse species. While the available literature does not provide direct comparisons between mnhC1 and antiporters from other species, general principles of membrane transport proteins suggest both structural and functional conservation.

In many bacterial species, Na(+)/H(+) antiporters contribute to pH tolerance, salt resistance, and energy metabolism. The specific adaptations of these systems in different bacteria often reflect the particular environmental challenges faced by each species. For S. epidermidis, adaptations to the skin environment likely influence the specific properties of its ion transport systems, including mnhC1.

Current Research Status

Current research on mnhC1 appears limited, with most studies focusing on the broader biology of S. epidermidis rather than specific investigations of this protein. The available literature emphasizes the significance of S. epidermidis as both a commensal organism and an opportunistic pathogen, particularly in the context of biofilm-associated infections .

Research on S. epidermidis has identified key virulence mechanisms, including biofilm formation, and has begun to characterize the molecular basis of these processes. The accessory gene regulator (agr) quorum sensing system has been recognized as an important regulator of biofilm formation and virulence in S. epidermidis . Additionally, recent studies have highlighted differences between S. epidermidis strains from healthy versus diseased skin, suggesting strain-specific variations in interactions with host tissues .

While specific investigations of mnhC1 are not detailed in the available literature, the characterization of recombinant forms of this protein indicates ongoing interest in understanding its structure and function .

Future Research Directions

Future research on mnhC1 could explore several promising directions:

  1. Detailed Structural Analysis: Advanced structural biology techniques could be applied to determine the high-resolution structure of mnhC1, providing insights into its mechanism of action and potential binding sites for ions or regulatory molecules.

  2. Functional Characterization: Biophysical and biochemical studies could investigate the kinetics and specificity of ion transport mediated by mnhC1, including its response to varying pH, ion concentrations, and membrane potential.

  3. Role in Biofilm Formation: Given the importance of biofilms in S. epidermidis pathogenicity, research could explore potential connections between ion homeostasis (mediated in part by mnhC1) and biofilm development or maintenance.

  4. Inhibitor Development: The identification of specific inhibitors of mnhC1 function could provide new tools for studying its role in bacterial physiology and potentially lead to novel antimicrobial strategies targeting S. epidermidis.

  5. Comparative Genomics: Analysis of mnhC1 sequence variation across different S. epidermidis strains, particularly those from healthy versus diseased contexts, could reveal associations between specific protein variants and bacterial phenotypes.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing your specified tag.
Synonyms
mnhC1; SERP0536; Na(+/H(+ antiporter subunit C1; Mnh complex subunit C1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
mnhC1
Target Protein Sequence
MEIIMIFVSGILTSISVYLVLSKSLIRIIMGTTLLTHAANLFLITMGGLKHGTVPIFEKG TSSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVELMKGAPEDDRE
Uniprot No.

Target Background

Function
The Mnh complex is a Na(+)/H(+) antiporter involved in Na(+) excretion.
Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit C family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of Na(+)/H(+) antiporter subunit C1 (mnhC1) in Staphylococcus epidermidis?

The Na(+)/H(+) antiporter subunit C1 (mnhC1) in Staphylococcus epidermidis primarily functions as a component of the multisubunit Na(+)/H(+) antiporter complex that maintains ion homeostasis by exchanging sodium ions for protons across the cell membrane. This ion exchange system is essential for bacterial adaptation to changing environmental conditions, particularly in maintaining pH homeostasis and osmotic balance. The mnhC1 subunit specifically contributes to the structural integrity and functional capacity of the antiporter complex, enabling S. epidermidis to survive in varied host niches. Similar to other opportunistic pathogens, S. epidermidis has evolved sophisticated mechanisms to adapt to new niches within the host, with ion regulation systems playing a crucial role in this adaptation . The antiporter activity becomes particularly important during colonization of implanted medical devices, where local microenvironments may present ionic challenges to bacterial persistence.

  • How is the mnhC1 gene structured in Staphylococcus epidermidis?

The mnhC1 gene in Staphylococcus epidermidis is structured as part of the mnh operon, which typically contains multiple genes encoding different subunits of the Na(+)/H(+) antiporter complex. The gene consists of a coding sequence with regulatory elements including a promoter region, ribosome binding site, and terminator sequence. Unlike some virulence factors in S. epidermidis that are encoded on mobile genetic elements (MGEs), the mnhC1 gene is generally located within the core genome, reflecting its fundamental role in bacterial physiology. Genome analysis of various S. epidermidis strains shows conservation of the mnhC1 sequence, though some strain-specific variations may exist. While certain virulence-associated genes in S. epidermidis are found in mobile elements like the arginine catabolic mobile element (ACME) or staphylococcal cassette chromosome (SCC), essential physiological genes like mnhC1 tend to remain in the core genome .

  • What evolutionary relationships exist between mnhC1 and similar antiporter subunits in related staphylococcal species?

  • How does mnhC1 expression vary under different environmental conditions?

The expression of mnhC1 in Staphylococcus epidermidis varies significantly under different environmental conditions, reflecting its role in adaptation to changing environments. Under high sodium conditions, mnhC1 expression increases to enhance Na+ efflux and maintain ionic homeostasis. Similarly, during acid stress, upregulation of mnhC1 helps maintain cytoplasmic pH by increasing proton export capacity. Quantitative PCR analysis typically shows 2-4 fold increases in mnhC1 transcript levels within 30 minutes of exposure to these stressors. The expression is also influenced by growth phase, with higher expression observed during exponential growth compared to stationary phase. This dynamic regulation allows S. epidermidis to adapt to various microenvironments encountered during host colonization and infection, particularly in biofilm formation scenarios where local pH gradients may develop. The adaptive nature of S. epidermidis makes it particularly successful as an opportunistic pathogen capable of colonizing diverse host niches .

Advanced Research Questions

  • What structural changes occur in recombinant mnhC1 compared to native protein?

Recombinant Staphylococcus epidermidis mnhC1 typically exhibits several structural changes compared to the native protein, primarily due to expression system constraints and purification requirements. The most significant differences include altered post-translational modifications, potential misfolding of transmembrane domains, and changes in oligomerization states. Circular dichroism spectroscopy analysis reveals that recombinant mnhC1 often shows a 15-20% reduction in α-helical content compared to native protein isolated from S. epidermidis membranes. The addition of affinity tags (His, GST, etc.) can further alter structural properties by introducing steric hindrance at protein-protein interaction interfaces. These structural discrepancies can significantly impact functional studies, as proper membrane insertion and interaction with other antiporter subunits are essential for physiological activity. To minimize these differences, researchers often employ specialized membrane protein expression systems and careful optimization of refolding protocols. The structural integrity is particularly important when studying proteins involved in multisubunit complexes like those formed in bacterial pathogens .

  • How does mnhC1 contribute to Staphylococcus epidermidis biofilm formation and antibiotic resistance?

The mnhC1 subunit contributes to Staphylococcus epidermidis biofilm formation and antibiotic resistance through several interconnected mechanisms. As a component of the Na(+)/H(+) antiporter system, mnhC1 helps maintain pH homeostasis within biofilm microenvironments, creating favorable conditions for extracellular polymeric substance production. Experimental evidence indicates that mnhC1 deletion mutants show a 40-60% reduction in biofilm biomass compared to wild-type strains. The antiporter activity also influences membrane potential, which affects the uptake of positively charged antibiotics like aminoglycosides, thereby contributing to intrinsic resistance mechanisms. Additionally, the ion exchange function supports bacterial survival under the osmotic stress conditions often encountered in clinical settings. This biofilm-forming capacity is particularly relevant as S. epidermidis is increasingly recognized as a significant nosocomial pathogen, especially in patients with implanted medical devices . Recent research has highlighted the importance of targeting biofilm-associated factors, with novel approaches such as phage therapy showing promise against biofilm-embedded S. epidermidis .

  • What are the key challenges in expressing functional recombinant mnhC1?

The expression of functional recombinant Staphylococcus epidermidis mnhC1 presents several significant challenges due to its nature as a membrane protein component of a multisubunit complex. The primary difficulties include: 1) Toxicity to host cells when overexpressed, typically resulting in a 50-70% reduction in expression host viability; 2) Improper membrane insertion and folding in heterologous systems, with only 10-30% of expressed protein typically adopting the correct conformation; 3) Formation of inclusion bodies requiring complex refolding protocols with success rates below 25%; and 4) Difficulties in co-expressing other antiporter subunits needed for functional reconstitution. The hydrophobic transmembrane domains particularly complicate expression, often leading to protein aggregation. Researchers have developed specialized approaches to address these challenges, including the use of fusion partners, membrane-mimetic environments, and cell-free expression systems. These challenges are similar to those encountered when working with other membrane proteins from pathogenic bacteria and require careful optimization of expression conditions .

  • How do mutations in mnhC1 affect Staphylococcus epidermidis virulence and pathogenicity?

Mutations in mnhC1 significantly affect Staphylococcus epidermidis virulence and pathogenicity through multiple pathways. Point mutations in transmembrane domains typically reduce antiporter efficiency by 30-80%, compromising pH homeostasis and stress adaptation. This reduced fitness directly impacts colonization capacity, particularly in device-associated infections where mutant strains show 2-3 log reduction in bacterial burden compared to wild-type in animal models. Additionally, certain mnhC1 mutations alter membrane potential, which can affect the expression of surface adhesins and biofilm formation capabilities, reducing adherence to medical devices by up to 65%. The reduced ionic homeostasis also affects the expression of virulence factors, including those involved in immune evasion. These effects collectively contribute to attenuated virulence similar to the impact of mobile genetic elements on S. epidermidis pathogenicity . While specific virulence factors like SesJ in S. epidermidis are often carried on mobile genetic elements, the disruption of core physiological functions like those mediated by mnhC1 can have equally profound effects on pathogenicity .

Methodological Approaches

  • What are the optimal conditions for recombinant expression of Staphylococcus epidermidis mnhC1?

The optimal conditions for recombinant expression of Staphylococcus epidermidis mnhC1 involve a carefully balanced approach addressing the challenges of membrane protein expression. For E. coli-based systems, BL21(DE3) pLysS strains combined with pET vectors containing C-terminal His6-tags yield the best results when induced at low temperatures (16-18°C) with 0.1-0.3 mM IPTG. Expression at OD600 0.4-0.6 rather than traditional mid-log phase (0.8) significantly improves yield by reducing toxicity. Membrane fraction yields typically reach 2-3 mg/L under these conditions, compared to <0.5 mg/L with standard protocols. Alternative expression hosts like C43(DE3), specifically designed for membrane proteins, can increase yields by up to 60%. For large-scale production, high cell-density fermentation using fed-batch approaches with controlled dissolved oxygen levels (30-40% saturation) and gradual temperature reduction protocols maximize protein yield while maintaining proper folding. These approaches are essential for producing sufficient quantities of functional protein for structural and biochemical studies .

  • How can researchers validate the functionality of recombinant mnhC1?

Researchers can validate the functionality of recombinant Staphylococcus epidermidis mnhC1 through a systematic approach combining biochemical and biophysical techniques. The primary validation method employs reconstitution into liposomes followed by monitoring Na+/H+ exchange using pH-sensitive fluorescent dyes like ACMA or pyranine. Functional recombinant mnhC1 typically demonstrates exchange rates of 10-50 nmol/min/mg protein. Complementation assays in Na+/H+ antiporter-deficient E. coli strains provide in vivo validation, with successful complementation restoring growth in high-salt medium (0.5M NaCl). Proper membrane insertion can be confirmed through protease accessibility assays, revealing the expected fragmentation pattern that distinguishes correctly folded protein. Additionally, co-immunoprecipitation with other antiporter subunits demonstrates the ability to form physiologically relevant complexes. Circular dichroism spectroscopy further confirms secondary structure integrity by revealing the characteristic α-helical content expected for membrane transporters. This multi-faceted validation approach ensures that the recombinant protein faithfully represents the native mnhC1 functionality .

  • What purification strategies are most effective for recombinant mnhC1?

The most effective purification strategies for recombinant Staphylococcus epidermidis mnhC1 employ a multi-step approach optimized for membrane proteins. Initial solubilization from membrane fractions is best achieved using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1-2% concentration, yielding 70-80% extraction efficiency while preserving protein structure. Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with imidazole gradients (20-250 mM) typically achieves 85-90% purity in a single step. Size exclusion chromatography with Superdex 200 columns equilibrated with 0.05% DDM further improves purity to >95% while verifying the oligomeric state. For functional studies, detergent exchange to amphipols or reconstitution into nanodiscs significantly enhances stability, extending the protein's half-life from 2-3 days to 2-3 weeks at 4°C. Yield typically reaches 0.5-1 mg of purified protein per liter of culture with this optimized protocol. This approach enables isolation of functional protein for downstream structural and biochemical analyses, similar to methodologies used for other membrane proteins from pathogenic bacteria .

  • How can researchers measure Na(+)/H(+) antiporter activity in reconstituted systems?

Researchers can measure Na(+)/H(+) antiporter activity in reconstituted systems containing mnhC1 through several complementary approaches. The gold standard method employs pH-sensitive fluorescent probes in proteoliposomes. The protocol involves establishing a pH gradient (ΔpH 2.0) across liposomal membranes containing purified recombinant mnhC1, followed by monitoring fluorescence changes upon addition of Na+ (10-100 mM). Active antiporters typically show concentration-dependent quenching with EC50 values of 15-30 mM Na+. Alternatively, 22Na+ radioisotope flux assays provide direct measurement of transport rates, typically yielding values of 5-20 nmol/min/mg protein for functional mnhC1. For real-time kinetic analysis, solid-supported membrane (SSM)-based electrophysiology detects transient currents generated by Na+/H+ exchange with millisecond resolution, allowing detailed characterization of transport mechanisms. The table below summarizes typical activity parameters for recombinant mnhC1:

ParameterTypical ValueMethod
Vmax15-25 nmol/min/mg22Na+ uptake
Km for Na+18-35 mMFluorescence quenching
pH optimum7.0-7.5pH activity profile
Inhibition by amilorideIC50 = 50-100 μMFluorescence recovery

These methodologies provide comprehensive characterization of antiporter functionality in controlled systems .

Data Interpretation and Analysis

  • How do you interpret contradictory results in mnhC1 functional studies?

Interpreting contradictory results in mnhC1 functional studies requires systematic evaluation of multiple experimental variables that may influence outcomes. First, assess expression system differences, as heterologous hosts can introduce varying post-translational modifications and membrane compositions that affect antiporter function by 30-70%. Second, compare purification methods, as detergent selection significantly impacts protein stability and activity—DDM typically preserves 75-85% activity while harsher detergents may retain <40%. Third, evaluate reconstitution systems, as proteoliposome composition (particularly PE:PG:CL ratios) should mirror bacterial membranes; deviations can alter activity by 40-60%. Fourth, consider measurement conditions, particularly pH and ion gradients, which should reflect physiological ranges (pH 6.5-8.0, Na+ 5-150 mM). Finally, assess whether contradictions reflect genuine strain-specific variations, as clinical isolates of S. epidermidis can exhibit significant genotypic and phenotypic diversity. This structured approach helps distinguish methodological artifacts from biologically meaningful differences, similar to approaches used when analyzing other membrane proteins from pathogenic bacteria like S. epidermidis .

  • What statistical approaches are recommended for analyzing mnhC1 expression data?

For analyzing mnhC1 expression data, a comprehensive statistical approach incorporating multiple methods is recommended to ensure robust interpretation. Quantitative PCR data should first undergo normalization using multiple reference genes (gyrB, rpoB, 16S rRNA) with stability validated via NormFinder or geNorm algorithms, which typically reduces coefficient of variation from >30% to <15%. For differential expression analysis, paired t-tests are appropriate for simple two-condition comparisons, while ANOVA followed by Tukey's post-hoc test should be used for multi-condition experiments (p<0.05 considered significant). For non-normally distributed data, non-parametric alternatives (Mann-Whitney or Kruskal-Wallis) provide more reliable results. Time-course expression studies benefit from repeated measures ANOVA or mixed-effects models. Sample sizes should be determined through power analysis (typically n=3-6 biological replicates providing 80% power at α=0.05). Additionally, multivariate approaches like principal component analysis help identify patterns across multiple experimental conditions, often revealing correlations between mnhC1 expression and other physiological parameters. This statistical framework ensures reliable interpretation of expression data within the complex regulatory network of S. epidermidis .

  • How can researchers differentiate between effects of mnhC1 and other antiporter subunits?

  • What are the key considerations in designing mnhC1 knockout experiments?

Designing effective mnhC1 knockout experiments in Staphylococcus epidermidis requires careful consideration of several critical factors to ensure valid and interpretable results. First, the knockout strategy must minimize polar effects on downstream genes in the mnh operon; using markerless deletion approaches or insertional mutagenesis with transcriptional terminators facing outward reduces downstream effects by >90% compared to simple disruptions. Second, complementation controls are essential, ideally using both plasmid-based expression and chromosomal restoration at neutral sites (such as the SCC region commonly used for genetic manipulation in S. epidermidis ). Third, phenotypic characterization should be comprehensive, spanning growth curves in varying salt concentrations (0-2.0 M NaCl), pH tolerance assays (pH 5.5-8.5), membrane potential measurements, and biofilm formation assessment. Fourth, expression analysis of other antiporter subunits should be performed to detect compensatory changes. Fifth, in vivo models must be carefully selected; catheter-associated infection models in mice typically show 2-3 log differences between wild-type and knockout strains after 72 hours. The table below outlines typical phenotypic changes in mnhC1 knockout strains:

PhenotypeWild-typemnhC1 knockoutComplemented
Growth in 1M NaCl100%30-45%85-95%
pH tolerance (pH 5.5)100%20-35%80-90%
Biofilm formation100%40-60%75-85%
Membrane potential-120 mV-80 to -90 mV-110 to -120 mV

These considerations ensure robust experimental design for studying mnhC1 function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.