Recombinant Staphylococcus epidermidis Na (+)/H (+) antiporter subunit E1 (mnhE1)

Shipped with Ice Packs
In Stock

Description

Introduction to Staphylococcus epidermidis Na(+)/H(+) Antiporter Subunit E1 (mnhE1)

Staphylococcus epidermidis Na(+)/H(+) Antiporter Subunit E1 (mnhE1) functions as an integral membrane protein component within the multisubunit Na(+)/H(+) antiporter complex in Staphylococcus epidermidis. This gram-positive bacterium exists as a permanent member of the normal human microbiota, commonly establishing residence on skin and mucous membranes . The mnhE1 protein, designated as a subunit of the Mnh (multisubunit Na+/H+) antiporter complex, contributes significantly to bacterial ion homeostasis mechanisms that are essential for cellular function and survival.

Na(+)/H(+) antiporters represent specialized integral membrane proteins that facilitate the exchange of sodium ions (Na+) for protons (H+) across bacterial cell membranes. These sophisticated transport systems serve multiple critical physiological functions, including regulation of intracellular pH, modulation of sodium concentrations, cell volume control, and adaptation to environments with varying salt concentrations or pH levels. The Mnh complex in S. epidermidis incorporates multiple subunits working in concert, with mnhE1 serving as one essential component required for proper assembly and function of this ion transport machinery.

S. epidermidis has gained significant attention in clinical settings as an opportunistic pathogen, particularly in association with implanted medical devices. Research has established that this organism causes approximately 20% of all orthopedic device-related infections, with rates increasing to 50% in late-developing infections . Understanding the molecular components that enable S. epidermidis to thrive in diverse environments, including the Na(+)/H(+) antiporter system, provides valuable insights into bacterial survival mechanisms and potential therapeutic targets.

Gene and Protein Information

The mnhE1 protein is encoded by the mnhE1 gene in the S. epidermidis genome and is uniquely identified in protein databases by the UniProt ID Q8CPV2 . This protein is also referenced by alternative designations including "SE_0642" and "Mnh complex subunit E1" . As a constituent of the larger Mnh complex, mnhE1 represents one component of a sophisticated multisubunit system evolved for efficient ion transport across bacterial membranes.

Role in Bacterial Physiology

The Na(+)/H(+) antiporter system incorporating mnhE1 executes several essential functions contributing to bacterial homeostasis:

Significance in S. epidermidis Biology

In S. epidermidis specifically, the Mnh complex including mnhE1 likely plays a crucial role in the organism's remarkable adaptability to diverse microenvironments on the human body. The skin presents varied conditions of pH, salt concentration, and moisture levels, all of which require sophisticated ion regulation mechanisms for bacterial survival. This adaptability contributes significantly to S. epidermidis' dual role as both a beneficial commensal organism and an opportunistic pathogen in certain clinical contexts.

While specific investigations focusing exclusively on mnhE1 function in S. epidermidis are currently limited in published literature, research on homologous proteins in related bacterial species suggests its fundamental importance for survival, particularly under environmental stress conditions. The protein's role may potentially extend to influencing antibiotic resistance mechanisms, as ion transport systems can indirectly affect antimicrobial efficacy through membrane potential and intracellular pH regulation.

Expression Systems and Production Methods

The recombinant production of S. epidermidis mnhE1 employs sophisticated biotechnological approaches to generate purified protein for research applications. According to product specifications, recombinant full-length mnhE1 protein is produced with an N-terminal Histidine tag to facilitate purification processes .

The production protocol typically follows these sequential steps:

First, the mnhE1 gene (encoding amino acids 1-159) is inserted into an expression vector containing appropriate regulatory elements. Second, the recombinant vector is transformed into Escherichia coli cells, which serve as the protein production host. Third, under controlled laboratory conditions, these E. coli cells express the mnhE1 protein with the attached His-tag. Fourth, bacterial cells are harvested and lysed to release the recombinant protein. Fifth, the His-tagged mnhE1 undergoes purification via affinity chromatography, typically using nickel or cobalt resins that selectively bind the histidine residues. Finally, the purified protein undergoes rigorous quality control testing for purity, identity, and integrity.

Immunological Applications

The highly purified recombinant mnhE1 protein can function as an antigen for generating specific antibodies with multiple research applications. These antibodies enable detection and quantification of native mnhE1 in bacterial samples, investigation of protein localization within bacterial cells, and immunoprecipitation studies to identify interacting protein partners. Such immunological tools greatly expand the methodological approaches available for studying this membrane transport protein.

Relevance to S. epidermidis Biology and Pathogenesis

The Na(+)/H(+) antiporter system, including mnhE1, likely contributes significantly to S. epidermidis' remarkable adaptability to diverse environments on the human body. This adaptability underlies the organism's success in both commensal and pathogenic contexts. Understanding the molecular mechanisms of these transport systems may provide insights into factors governing the transition between these states and potential intervention strategies.

Antimicrobial Resistance Considerations

S. epidermidis has demonstrated concerning levels of antimicrobial resistance, particularly methicillin resistance in S. epidermidis (MRSE) which has been found in 70-87% of infection-causing isolates . While mnhE1 itself has not been directly implicated in antibiotic resistance mechanisms, membrane transport systems can indirectly influence antimicrobial susceptibility through effects on membrane potential, intracellular pH, and general stress responses.

Research on the Na(+)/H(+) antiporter system could potentially reveal connections to resistance mechanisms or identify novel targets for antimicrobial development. As conventional antibiotics face increasing resistance challenges, targeting essential physiological systems like ion transport represents an alternative strategy worth exploration.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
mnhE1; SERP0534; Na(+/H(+ antiporter subunit E1; Mnh complex subunit E1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
mnhE1
Target Protein Sequence
MAIQFVINLLVSVIWLLVTNSYTLNNFVLGFILGLFLVYLLHRVLPGQFYLVRIYRIIML IITFLTELIKANFGVLKIILKPRIENKPGFFVYETELERDWQLVLLSNLITLTPGTVVLG ISDDRKKIYIHSIDFSTKEEEIQNIKSSLEKVVRKVGEK
Uniprot No.

Target Background

Function

The Mnh complex is a Na+/H+ antiporter involved in Na+ excretion.

Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit E family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.