Recombinant Staphylococcus epidermidis Na (+)/H (+) antiporter subunit G1 (mnhG1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mnhG1; SERP0532; Na(+/H(+ antiporter subunit G1; Mnh complex subunit G1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
mnhG1
Target Protein Sequence
MIATIVTSVSIIFVVLGALISAFAATGLIRLRDVYSRAHAAGKAATLGAMFLLFGAFLYF IGTEGYVNMQLIIGIIFVFITGPLSSHLIMKAAYNIKTPYTKDTKIDEIKEDMKHTKL
Uniprot No.

Target Background

Function
MnhG1 complex is a sodium/proton antiporter involved in sodium excretion.
Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit G family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the optimal expression system for recombinant S. epidermidis mnhG1?

Escherichia coli remains the preferred expression system for recombinant S. epidermidis mnhG1 due to its rapid growth, well-established genetic tools, and cost-effectiveness. For membrane proteins like mnhG1, E. coli BL21(DE3) or C43(DE3) strains are particularly effective as they are designed to accommodate potentially toxic membrane proteins. Expression vectors containing T7 promoters (pET series) provide tightly controlled, high-level expression when induced with IPTG. For enhanced stability, consider fusion tags such as His6, MBP, or SUMO at the N-terminus, as C-terminal modifications may interfere with proper membrane insertion of this antiporter subunit .

How do expression conditions affect the solubility and functionality of recombinant mnhG1?

Expression conditions critically impact both solubility and functionality of recombinant mnhG1. Based on experimental design approaches with other membrane proteins, optimal conditions typically include:

ParameterOptimal ConditionRationale
Temperature16-25°CReduces inclusion body formation; 25°C shows better results for membrane proteins
IPTG concentration0.1-0.5 mMLower concentrations favor proper folding
Induction time4-16 hoursExtended periods at lower temperatures improve folding
Media compositionEnriched media with 5-10 g/L tryptone, 5 g/L yeast extractProvides necessary nutrients for membrane protein synthesis
Cell density at inductionOD600 0.6-0.8Ensures cells are in mid-log phase for optimal expression
Growth at reduced temperatures (particularly 25°C) with moderate inducer concentrations (0.1 mM IPTG) has been demonstrated to significantly improve the yield of functional membrane proteins like antiporters in E. coli expression systems .

What are the key challenges in expressing mnhG1 as a functional protein?

Expressing functional mnhG1 presents several challenges inherent to membrane proteins. First, overexpression often leads to cellular toxicity and inclusion body formation due to overloading of the membrane insertion machinery. Second, proper folding requires the correct membrane environment, which is difficult to maintain in heterologous expression systems. Third, maintaining stability during purification necessitates appropriate detergent selection to replace the natural lipid environment. Finally, verification of functionality is complicated by the need to reconstitute the protein in artificial membrane systems that support ion transport. Addressing these challenges requires careful optimization of expression conditions, membrane extraction protocols, and functional assay systems specifically developed for Na+/H+ antiporters .

What purification strategy yields the highest purity of functional mnhG1?

A multi-step purification approach is recommended for obtaining high-purity, functional mnhG1:

  • Membrane Fraction Isolation: Lyse cells using sonication or French press in buffer containing protease inhibitors, followed by differential centrifugation to isolate membrane fractions (typically 100,000 × g for 1 hour).

  • Detergent Solubilization: Solubilize membrane fractions with mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations slightly above their critical micelle concentration.

  • Affinity Chromatography: Purify using nickel affinity chromatography if His-tagged, with detergent maintained throughout all buffers.

  • Size Exclusion Chromatography: Further purify using gel filtration to remove aggregates and obtain homogeneous protein.
    This approach typically yields protein with approximately 75-85% homogeneity, suitable for functional studies. Throughout purification, maintain a pH range of 7.0-8.0 and include 100-300 mM NaCl in all buffers to stabilize the antiporter structure .

How can researchers verify the structural integrity of purified mnhG1?

Verification of structural integrity requires multiple analytical approaches:

  • Circular Dichroism (CD) Spectroscopy: Analyze secondary structure content, particularly alpha-helical content expected in transmembrane domains of Na+/H+ antiporters.

  • Thermal Shift Assays: Assess protein stability under various buffer conditions using fluorescent dyes that bind to hydrophobic regions exposed during unfolding.

  • Limited Proteolysis: Properly folded membrane proteins show characteristic resistance to proteolytic digestion compared to misfolded variants.

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS): Determine oligomeric state and homogeneity of the purified protein in detergent micelles.

  • Negative Stain Electron Microscopy: Visualize protein particles to confirm homogeneity and absence of aggregation.
    These complementary techniques provide a comprehensive assessment of protein quality before proceeding to functional studies or structural analyses .

What experimental approaches can measure the Na+/H+ antiporter activity of recombinant mnhG1?

Several complementary approaches can be employed to measure antiporter activity:

  • Liposome Reconstitution Assays: Reconstitute purified mnhG1 into liposomes containing pH-sensitive fluorescent dyes (e.g., ACMA or pyranine). Monitor fluorescence changes upon addition of Na+ to assess H+ exchange.

  • Electrophysiological Measurements: Use patch-clamp techniques on proteoliposomes or whole-cell recordings from expression systems to directly measure ion currents.

  • Radioactive Ion Flux Assays: Measure the exchange of radioactively labeled ions (22Na+ or equivalent) in reconstituted liposomes to quantify transport rates.

  • pH Stat Methods: Continuously measure pH changes in the external medium during transport to determine stoichiometry and kinetics.
    When designing these experiments, control measurements using empty liposomes and inactive protein variants are essential to distinguish specific transport activity from non-specific ion leakage .

How does the structure of mnhG1 influence its ion transport mechanism?

The structure-function relationship of mnhG1 can be understood by examining other Na+/H+ antiporters. Similar to other bacterial antiporters, mnhG1 likely contains multiple transmembrane helices that undergo conformational changes during ion transport. Key structural features influencing function include:

  • Transmembrane Domains: Typically 12-13 transmembrane helices form the core structure, with several helices directly involved in ion binding and translocation.

  • Ion Binding Sites: Precise arrangements of charged and polar amino acids create selective binding pockets for Na+ and H+ ions.

  • Conformational Switch: An alternating access mechanism allows sequential exposure of ion binding sites to different sides of the membrane, facilitated by pH-sensitive residues that trigger conformational changes.

  • Dimeric Interface: Many Na+/H+ antiporters function as dimers, with the interface providing structural stability rather than being essential for ion transport.
    Site-directed mutagenesis studies targeting conserved residues in these regions can elucidate specific contributions to transport activity and selectivity .

What methods can determine the ion selectivity and stoichiometry of mnhG1?

Determining ion selectivity and stoichiometry requires specialized experimental approaches:

  • Ion Competition Assays: Measure transport activity in the presence of varying concentrations of different ions to determine relative affinities and selectivity.

  • Simultaneous Measurement of Multiple Ions: Use combinations of fluorescent probes and radioactive tracers to simultaneously track movement of Na+ and H+ ions.

  • Reversal Potential Measurements: Apply electrophysiological techniques to determine the equilibrium condition where net transport is zero, revealing the stoichiometry of exchange.

  • pH Dependence Profiling: Characterize activity across a range of pH values (pH 2-10) to identify optimal conditions and pH-sensitive regions of the transport cycle.
    The expected Na+/H+ exchange stoichiometry for most bacterial antiporters is 1:1 or 2:1, which can be verified using these approaches under varying ionic and pH conditions .

How does mnhG1 contribute to S. epidermidis biofilm formation and pathogenicity?

The contribution of mnhG1 to S. epidermidis biofilm formation and pathogenicity can be assessed through several experimental approaches:

  • Gene Knockout Studies: Create mnhG1 deletion mutants and assess their ability to form biofilms using crystal violet staining or confocal microscopy.

  • pH Microenvironment Analysis: Use pH-sensitive fluorescent probes to map pH gradients within biofilms of wild-type and mnhG1-deficient strains.

  • Transcriptomic Analysis: Compare gene expression profiles between planktonic and biofilm states to identify co-regulated pathways.

  • In vivo Infection Models: Test virulence of wild-type versus mnhG1-deficient strains in relevant animal models of device-associated infection.
    Current evidence suggests that Na+/H+ antiporters like mnhG1 play crucial roles in maintaining pH homeostasis within biofilms, particularly in acidic microenvironments created by metabolic activity. This pH regulation enables persistent colonization of implant surfaces and contributes to antimicrobial resistance by maintaining optimal cytoplasmic conditions for cellular function .

How can structural biology techniques be applied to study mnhG1?

Advanced structural biology approaches for studying mnhG1 include:

  • X-ray Crystallography: Requires crystallization of purified protein, typically facilitated by:

    • Lipidic cubic phase methods specifically designed for membrane proteins

    • Surface entropy reduction through mutagenesis of flexible regions

    • Use of antibody fragments to stabilize specific conformations

  • Cryo-Electron Microscopy: Increasingly preferred for membrane proteins due to:

    • Reduced sample requirements compared to crystallography

    • Ability to capture multiple conformational states

    • Visualization of protein within lipid nanodiscs to maintain native-like environment

  • Nuclear Magnetic Resonance (NMR): Useful for studying dynamics and ligand interactions:

    • Solid-state NMR applicable to membrane proteins in lipid environments

    • Solution NMR with detergent-solubilized protein for smaller domains

  • Molecular Dynamics Simulations: Complement experimental structures by modeling:

    • Ion permeation pathways

    • Conformational changes during transport cycle

    • Interactions with lipid bilayer components
      These approaches can reveal the molecular basis of ion selectivity, transport mechanisms, and potential sites for targeted inhibition .

What are the methodological approaches for studying mnhG1 interactions with host immune responses?

Investigating mnhG1 interactions with host immune responses requires multidisciplinary approaches:

  • Co-culture Experiments: Expose human monocyte-derived macrophages (hMDMs) to both wild-type and mnhG1-deficient S. epidermidis strains to assess differences in:

    • Phagocytosis rates (using fluorescence microscopy or flow cytometry)

    • Pro- vs. anti-inflammatory cytokine production (using ELISA or multiplex assays)

    • Gene expression changes in immune cells (using RNA-seq)

  • Pattern Recognition Receptor (PRR) Activation Assays: Determine if mnhG1 activates specific immune pathways:

    • Reporter cell lines expressing individual TLRs or NLRs

    • Inhibition studies using pathway-specific blockers

    • Pull-down assays to identify direct protein-protein interactions

  • In vivo Models with Immune Monitoring:

    • Use mouse models with implanted devices infected with wild-type or mutant strains

    • Monitor immune cell recruitment and activation

    • Assess device-associated biofilm formation and clearance rates
      These methods can elucidate whether mnhG1 directly modulates immune responses or indirectly affects pathogenicity through its ion transport function and contribution to bacterial stress resistance .

What are the key challenges and future directions in mnhG1 research?

Research on S. epidermidis mnhG1 faces several challenges that represent important future directions:

  • Functional Reconstitution: Developing improved methods for functional reconstitution in artificial membrane systems that better mimic the native environment.

  • Structural Determination: Obtaining high-resolution structures in multiple conformational states to fully understand the transport mechanism.

  • Systems Biology Integration: Understanding how mnhG1 function integrates with other cellular processes during biofilm formation and host interaction.

  • Therapeutic Targeting: Exploring mnhG1 as a potential target for novel anti-biofilm strategies, requiring development of specific inhibitors and screening methods.

  • Host-Pathogen Interface: Elucidating the role of mnhG1 in S. epidermidis adaptation to host environments, particularly in implant-associated infections.
    Progress in these areas will require interdisciplinary approaches combining molecular biology, structural biology, immunology, and clinical microbiology to address the increasing burden of S. epidermidis infections, particularly in healthcare settings with immunocompromised patients and medical implants .

How does current research on mnhG1 contribute to broader understanding of bacterial antiporters?

Research on mnhG1 contributes significantly to the broader understanding of bacterial antiporters in several ways:

  • Evolutionary Conservation: Comparative analyses of mnhG1 with other bacterial Na+/H+ antiporters reveal conserved structural and functional features that have evolved across different bacterial species.

  • Specialized Functions: Understanding how mnhG1 may be specifically adapted for S. epidermidis lifestyles (commensal and opportunistic pathogen) compared to antiporters in obligate pathogens or environmental bacteria.

  • Regulatory Networks: Elucidating how antiporter function is integrated with stress responses and virulence mechanisms provides insights into bacterial adaptation strategies.

  • Structure-Function Relationships: Detailed characterization of mnhG1 adds to the growing database of structure-function relationships in this important family of membrane transporters.
    The knowledge gained from mnhG1 research has implications for understanding bacterial adaptation to diverse environments, development of new antimicrobial strategies, and potentially for bioengineering applications requiring controlled ion transport systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.