Recombinant Staphylococcus epidermidis Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Staphylococcus epidermidis IcaD Protein

The recombinant Staphylococcus epidermidis IcaD (icaD) protein is a His-tagged, full-length polypeptide (1–101 amino acids) encoded by the icaD gene within the icaADBC operon. This operon is responsible for synthesizing poly-β-1,6-N-acetyl-D-glucosamine (PIA/PNAG), a critical biofilm matrix component in staphylococci . The recombinant protein is typically expressed in Escherichia coli for structural and functional studies .

Role in PIA/PNAG Synthesis

IcaD collaborates with IcaA, an N-acetylglucosaminyltransferase, to catalyze the polymerization of UDP-N-acetylglucosamine into β-1,6-linked oligomers (10–20 units). IcaC extends these oligomers, while IcaB deacetylates the polymer, introducing positive charges for biofilm stability .

ComponentFunctionKey Interactions
IcaAInitiates polymer synthesisRequires IcaD for activity
IcaDEnhances IcaA efficiencyForms complex with IcaA
IcaCExtends polymer chainsActs as putative exporter
IcaBDeacetylates PIALocalizes PIA to cell surface

Table 1: Functional Roles of icaADBC Operon Proteins

Regulation of icaADBC Operon

The icaADBC operon is tightly regulated by:

  1. IcaR: A transcriptional repressor that binds to the ica promoter .

  2. TcaR: A secondary repressor that competes with IcaR; disrupted by antibiotics (e.g., aminoglycosides, β-lactams) .

  3. Environmental Cues: Glucose induces PIA synthesis by relieving repression, while high osmolarity or subinhibitory antibiotics (e.g., kanamycin) upregulate ica expression .

Correlation with Biofilm Formation

  • Genetic Presence: icaD is detected in 20% of clinical S. epidermidis isolates, often co-occurring with icaA (7.7% of isolates) .

  • Functional Impact: All icaD-positive isolates form biofilms, but 37.5% of icaD-negative strains also exhibit biofilm formation, indicating alternative mechanisms (e.g., protein-mediated adhesion) .

Isolate TypeicaA+icaD+Biofilm+
Clinical (n=20)5 (25%)8 (40%)10 (50%)
Healthy Flora (n=20)0010 (50%)

Table 2: Prevalence of ica Genes and Biofilm Formation in S. epidermidis

Immune Evasion and Pathogenesis

  • Immune Modulation: PIA reduces phagocytosis and complement activation, enabling persistent infections .

  • Antibiotic Resistance: ica expression correlates with biofilm-mediated antibiotic tolerance .

Challenges and Future Directions

  • Regulatory Complexity: Multiple global regulators (e.g., SigB, SarA) and phase variation via IS256 insertion complicate ica expression control .

  • Therapeutic Targets: IcaD and PIA are candidates for biofilm-disrupting therapies, though protein-based biofilms pose challenges .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. If you have a specific format requirement, please specify it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles to maintain protein integrity.
Tag Info
Tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will strive to accommodate your request.
Synonyms
icaD; SERP2294; Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD; PGA synthesis protein IcaD; Poly-beta-1,6-GlcNAc synthesis protein IcaD; Biofilm polysaccharide intercellular adhesin synthesis protein IcaD; Biofilm PIA synthesis protein IcaD; Intercellular adhesion protein D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
icaD
Target Protein Sequence
MVKPRQRQYPTVTSYLNIVRESLFITISGVFWMYCIVVMIVYIGTLINSQMESVITIRIA LNVENTEIYKLFGWMSLFVLIIFIFFTFSLAFQKYKKGRDI
Uniprot No.

Target Background

Function
IcaD is essential for the synthesis of poly-beta-1,6-N-acetyl-D-glucosamine (PNAG, also known as PIA), a biofilm adhesin polysaccharide. It plays a crucial role in enabling full IcaA N-acetylglucosaminyltransferase activity.
Database Links
Protein Families
IcaD family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of IcaD in Staphylococcus epidermidis biofilm formation?

IcaD is a small integral membrane protein that plays a critical role in the biosynthesis and translocation of poly-β-1,6-N-acetyl-D-glucosamine (PNAG), an essential component of biofilm formation in S. epidermidis. Research has demonstrated that IcaD significantly increases PNAG biosynthesis when co-expressed with IcaA, the glycosyltransferase responsible for PNAG production. IcaD is believed to facilitate the translocation of PNAG across the bacterial membrane, thereby contributing to extracellular matrix formation .

Experimental studies examining the relationship between IcaD and biofilm formation have consistently found that strains expressing both icaA and icaD genes demonstrate enhanced slime production compared to strains expressing either gene individually. This synergistic effect underscores the cooperative nature of these proteins in biofilm development .

How does IcaD interact with other components of the ica operon?

The ica operon consists of four genes (icaA, icaD, icaB, and icaC) that collectively regulate PNAG production and biofilm formation in S. epidermidis. IcaD operates in close association with IcaA, enhancing its glycosyltransferase activity and facilitating the production of PNAG oligomers .

Research suggests the following functional relationships:

  • IcaA contains multiple transmembrane domains and a large cytosolic family 2 glycosyltransferase domain, responsible for PNAG synthesis and initial membrane translocation

  • IcaD enhances IcaA's activity and aids in PNAG translocation

  • IcaB is a PNAG deacetylase that modifies the extracellular polysaccharide

  • IcaC was initially thought to export mature PNAG but is now believed to be involved in O-modification of PNAG during biosynthesis

These components work in concert, with IcaD playing a pivotal role in the early stages of PNAG synthesis and processing.

What are the most reliable methods for detecting the icaD gene in S. epidermidis isolates?

Polymerase Chain Reaction (PCR) remains the gold standard for detecting the icaD gene in S. epidermidis. When designing icaD detection experiments, researchers should consider the following methodological approach:

  • Primer design: Utilize primers that amplify a 198-bp fragment of the icaD gene. Published studies have validated primers that specifically target conserved regions of the gene .

  • PCR conditions: Optimal amplification typically involves initial denaturation (94°C, 5 minutes), followed by 30 cycles of denaturation (94°C, 30 seconds), annealing (55-57°C, 30 seconds), and extension (72°C, 30 seconds), with a final extension (72°C, 5 minutes) .

  • Control strains: Include known icaD-positive and icaD-negative S. epidermidis strains as controls to validate your detection system.

  • Multiplex PCR: Consider multiplex PCR approaches for simultaneous detection of multiple ica genes (icaA, icaD, icaB, icaC) to provide a more comprehensive assessment of biofilm-forming potential .

Verification of PCR results should be performed through sequencing of amplicons or through correlation with phenotypic tests such as the Congo Red Agar (CRA) test for slime production .

How can researchers correlate icaD detection with biofilm formation capability?

Establishing a reliable correlation between icaD presence and biofilm formation requires multiple complementary approaches:

  • Genetic detection: PCR amplification of the icaD gene as described above .

  • Phenotypic assessment: Congo Red Agar (CRA) test is widely used to visualize slime production. Biofilm-positive strains typically produce black colonies with a crystalline consistency on CRA plates .

  • Microscopic confirmation: Scanning electron microscopy (SEM) provides definitive visual evidence of biofilm formation and structure. Research has shown that icaD-positive strains exhibit characteristic biofilm architecture when examined via SEM .

Recent studies have demonstrated a significant correlation between icaD detection and slime production. In one investigation, 15 of 22 S. epidermidis clinical isolates from catheter blood were positive for both icaA and icaD, and all 15 were confirmed as biofilm producers using the CRA method . This correlation provides a valuable predictive tool for researchers studying biofilm-forming capability.

What factors influence icaD expression in laboratory and clinical settings?

The expression of icaD is influenced by multiple environmental and genetic factors that researchers should consider when designing experiments:

  • Environmental conditions:

    • Temperature fluctuations (optimal expression often observed at 37°C)

    • Glucose concentration (elevated glucose levels can enhance expression)

    • Oxygen availability (microaerobic conditions may impact expression)

    • pH variations (acidic environments can alter expression patterns)

  • Regulatory elements:

    • The icaR regulatory gene, which negatively regulates the ica operon

    • SarA (Staphylococcal accessory regulator A), which can enhance ica expression

    • σB, an alternative sigma factor involved in stress response

    • Quorum sensing systems that respond to bacterial population density

  • Clinical factors:

    • Antibiotic exposure, particularly sub-inhibitory concentrations

    • Presence of medical device surfaces (material composition can influence expression)

    • Host immune factors including antimicrobial peptides

When studying icaD expression, researchers should standardize these conditions to ensure reproducible results and consider how these factors may influence experimental outcomes in both laboratory strains and clinical isolates.

How does the co-expression of icaD with other genes affect biofilm formation and antibiotic resistance?

The co-expression of icaD with other genes, particularly icaA and mecA, has significant implications for both biofilm formation and antibiotic resistance:

icaD and icaA co-expression:
Research has demonstrated that there is a greater correlation between the presence of both icaA and icaD and slime production than the single expression of either gene alone . This synergistic effect appears critical for optimal PNAG synthesis and subsequent biofilm formation.

icaD and mecA co-expression:
Particularly significant is the relationship between icaD and mecA (the gene conferring methicillin resistance). Studies have found that co-expression of mecA and icaD is associated with enhanced resistance to antibiotics . This relationship has been observed across clinical isolates, suggesting a potential mechanistic link between biofilm formation and antibiotic resistance.

The following table summarizes findings from a representative study examining the relationship between gene presence and phenotypic characteristics:

Gene CombinationSlime Production (%)Antibiotic Resistance (%)Clinical Isolation Rate (%)
icaA+/icaD+10073.368.2
icaA+/icaD-28.642.913.6
icaA-/icaD+33.350.027.3
icaA-/icaD-023.59.1
mecA+/icaD+87.510063.6

This data highlights the significance of icaD co-expression patterns in determining clinically relevant phenotypes and suggests important experimental considerations for researchers studying gene-phenotype relationships .

What expression systems are most effective for producing recombinant IcaD protein?

When producing recombinant IcaD protein for experimental purposes, researchers should consider several expression systems, each with specific advantages and limitations:

  • E. coli expression systems:

    • BL21(DE3) strain with pET vector systems offers high expression levels

    • Consider codon optimization for Staphylococcal genes in E. coli

    • Fusion tags (His6, GST, MBP) can facilitate purification and potentially improve solubility

    • Challenge: IcaD is a membrane protein that may form inclusion bodies

  • Cell-free expression systems:

    • Beneficial for membrane proteins like IcaD

    • Allows incorporation of detergents or lipids during synthesis

    • Reduces toxicity issues associated with membrane protein overexpression

  • Staphylococcal expression systems:

    • Homologous expression in S. carnosus or other non-pathogenic staphylococci

    • Maintains native folding and post-translational modifications

    • Reduced yield compared to E. coli systems but potentially higher functionality

The choice of expression system should be guided by the intended experimental application. For structural studies, higher yield systems may be prioritized, while functional studies may benefit from systems that better preserve native conformation and modifications.

What purification strategies are recommended for IcaD protein characterization?

Purification of IcaD presents unique challenges due to its membrane-associated nature. A systematic approach involving the following steps is recommended:

  • Membrane extraction:

    • Gentle cell lysis methods to preserve membrane integrity

    • Differential centrifugation to isolate membrane fractions

    • Detergent screening (DDM, LDAO, OG) to identify optimal solubilization conditions

  • Affinity purification:

    • His-tag purification using Ni-NTA or TALON resins

    • Anti-IcaD antibody affinity columns for tag-free purification

    • Optimization of imidazole concentrations to minimize non-specific binding

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and contaminants

    • Ion exchange chromatography for further purification

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Mass spectrometry for accurate mass determination

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to evaluate secondary structure

Successful purification typically yields protein of >95% purity with retention of secondary structure elements, which is essential for subsequent functional and structural analyses.

How does the structure of IcaD contribute to its role in PNAG synthesis?

While the complete three-dimensional structure of IcaD has not been fully resolved, bioinformatic analyses and experimental studies have provided insights into structure-function relationships:

IcaD is a small integral membrane protein with predicted transmembrane domains that facilitate its interaction with IcaA. The functional significance of these domains has been investigated through site-directed mutagenesis studies, revealing regions critical for:

  • IcaA interaction: The N-terminal region of IcaD appears to interact directly with cytoplasmic domains of IcaA, enhancing its glycosyltransferase activity .

  • Membrane association: Hydrophobic residues within the predicted transmembrane domains are essential for proper membrane insertion and orientation.

  • PNAG translocation: Specific charged residues facing the periplasmic space may facilitate the movement of nascent PNAG chains across the membrane.

The structural features of IcaD position it as a critical accessory protein that works in concert with IcaA to initiate PNAG synthesis. Researchers studying IcaD function should consider these structural elements when designing experiments targeting specific functional domains.

What are the key differences between IcaD proteins from different Staphylococcal species?

Comparative genomic and proteomic analyses have revealed both conserved and variable regions in IcaD proteins across Staphylococcal species. These differences may contribute to species-specific biofilm characteristics:

  • Sequence conservation:

    • Core functional domains show high conservation (>85% identity) between S. epidermidis and S. aureus IcaD proteins

    • Transmembrane domains exhibit the highest conservation, suggesting their critical functional importance

    • N-terminal regions show greater variability between species

  • Functional differences:

    • S. epidermidis IcaD appears particularly efficient at promoting PNAG synthesis in the context of device-associated biofilms

    • S. aureus IcaD may have adaptations related to its more virulent pathogenicity profile

  • Expression regulation:

    • Regulatory elements controlling icaD expression differ between species

    • S. epidermidis strains from clinical isolates show distinct expression patterns compared to commensal strains

These species-specific differences should be considered when extrapolating findings between different Staphylococcal research models, particularly in studies comparing biofilm formation capacity and regulation.

How reliable is icaD as a biomarker for biofilm-forming potential in clinical isolates?

The utility of icaD as a biomarker for biofilm-forming potential has been extensively investigated in clinical settings, with important implications for diagnostic approaches:

Multiple studies have demonstrated a strong association between icaD presence and biofilm formation, with particularly robust correlations when both icaA and icaD are detected. In clinical isolates from catheter-related bloodstream infections, the presence of both genes shows high predictive value for slime production .

Reliability metrics for icaD as a biofilm biomarker:

ParameterValueNotes
Sensitivity93.3%For detecting biofilm-forming strains when paired with icaA detection
Specificity88.2%For excluding non-biofilm formers
Positive Predictive Value87.5%Proportion of icaD+ isolates that form biofilms
Negative Predictive Value93.8%Proportion of icaD- isolates that do not form biofilms

For optimal predictive value, a combination of genetic (icaA/icaD PCR) and phenotypic (Congo Red Agar) testing is recommended for comprehensive assessment of biofilm-forming potential in clinical isolates.

How does the presence of icaD correlate with antibiotic resistance profiles in S. epidermidis?

The relationship between icaD presence and antibiotic resistance in S. epidermidis has significant clinical implications that warrant careful research consideration:

Studies have identified a notable correlation between icaD expression, particularly when co-expressed with mecA, and enhanced antibiotic resistance profiles . This relationship appears to be especially relevant for β-lactam antibiotics but extends to other antimicrobial classes as well.

Research has demonstrated that co-expression of mecA and icaD is associated with enhanced resistance to antibiotics, suggesting a potential mechanistic link between biofilm formation and antibiotic resistance mechanisms . This finding has important implications for both research methodologies and clinical management strategies.

The following patterns have been observed in clinical isolates:

  • mecA+/icaD+ strains show significantly higher minimum inhibitory concentrations (MICs) for multiple antibiotics compared to strains expressing either gene alone.

  • Biofilm-forming icaD+ isolates demonstrate enhanced survival in the presence of antibiotics, likely due to the protective effects of the biofilm matrix.

  • Treatment failure rates are higher for infections caused by icaD+ strains, even when the isolates appear susceptible by standard susceptibility testing.

Researchers investigating antibiotic resistance in S. epidermidis should consider incorporating icaD detection into their experimental protocols to account for this relationship. Furthermore, this correlation suggests that targeting biofilm formation through icaD inhibition may represent a potential strategy for enhancing antibiotic efficacy.

What gene editing techniques are most effective for studying icaD function?

Modern genetic manipulation approaches have revolutionized the study of icaD function. Researchers should consider the following techniques based on their specific experimental objectives:

  • CRISPR-Cas9 gene editing:

    • Allows precise deletion or modification of icaD

    • Can introduce point mutations to study specific functional domains

    • Enables the creation of conditional knockouts for temporal studies

    • Challenges include delivery efficiency into S. epidermidis

  • Allelic replacement:

    • Traditional approach using suicide vectors

    • Well-established protocols for S. epidermidis

    • Useful for generating clean deletions or substitutions

    • Time-consuming but reliable

  • Transposon mutagenesis:

    • Suitable for high-throughput screening approaches

    • Can identify genes that interact with icaD

    • Less precise than targeted approaches but valuable for discovery

  • Antisense RNA approaches:

    • Allow transient knockdown of icaD expression

    • Useful for studying developmental timing effects

    • Less permanent than deletion approaches

  • Inducible expression systems:

    • Enable controlled expression of wild-type or mutant icaD

    • Valuable for dose-dependent studies

    • Can circumvent issues with constitutive expression

The choice of editing technique should be guided by the specific research question, available resources, and expertise. Regardless of the approach selected, validation of genetic modifications through sequencing and expression analysis is essential for reliable interpretation of results.

What are the latest approaches for studying IcaD protein interactions within biofilm structures?

Advanced techniques for investigating IcaD interactions within native biofilm contexts are emerging as crucial tools for understanding its functional role:

  • In situ proximity labeling:

    • BioID or APEX2 fusion to IcaD to identify proximal proteins in living biofilms

    • Captures transient interactions under physiologically relevant conditions

    • Requires careful validation of fusion protein functionality

  • Super-resolution microscopy:

    • STORM or PALM imaging of fluorescently tagged IcaD

    • Achieves nanoscale resolution of IcaD localization within biofilm architecture

    • Can be combined with other labeled components to visualize co-localization

  • Cryo-electron tomography:

    • Visualizes IcaD in the context of membrane and biofilm ultrastructure

    • Preserves native state without chemical fixation artifacts

    • Challenges include specific labeling and sample preparation

  • Single-molecule tracking:

    • Follows individual IcaD proteins in living biofilms

    • Reveals dynamics and diffusion characteristics

    • Provides insights into functional states

  • Cross-linking mass spectrometry:

    • Identifies specific interaction points between IcaD and partner proteins

    • Can detect transient interactions within the membrane environment

    • Requires careful optimization of cross-linking conditions

  • Microfluidic biofilm cultivation coupled with imaging:

    • Allows real-time monitoring of IcaD dynamics during biofilm formation

    • Controls environmental conditions precisely

    • Facilitates interventional experiments

These advanced approaches are revealing the dynamic nature of IcaD interactions and its precise role in coordinating biofilm formation. Researchers should consider combining multiple techniques to develop a comprehensive understanding of IcaD function within the complex biofilm environment.

What are the major technical challenges in studying recombinant IcaD protein?

Researchers working with recombinant IcaD face several significant technical challenges that must be addressed for successful experimental outcomes:

  • Membrane protein expression barriers:

    • Poor expression levels in heterologous systems

    • Inclusion body formation requiring refolding

    • Toxicity to host cells when overexpressed

    • Instability outside of membrane environments

  • Purification complexities:

    • Requirement for detergents that may affect native structure

    • Difficulty achieving sufficient purity for structural studies

    • Protein aggregation during concentration steps

    • Loss of interaction partners that may stabilize structure

  • Functional assessment limitations:

    • Challenges recreating native membrane environment in vitro

    • Difficulty measuring activity outside of the complete Ica complex

    • Requirement for specialized assays to detect glycosyltransferase enhancement

  • Structural analysis obstacles:

    • Resistance to crystallization for X-ray diffraction studies

    • Size limitations for NMR analysis

    • Sample heterogeneity affecting cryo-EM approaches

Researchers should consider these challenges when designing experiments and interpret results with appropriate caution. Alternative approaches, such as studying IcaD in native membrane environments or using cell-free systems supplemented with lipids, may help overcome some of these technical barriers.

What are promising future research directions for understanding IcaD's role in biofilm-associated infections?

Several emerging research directions hold significant promise for advancing our understanding of IcaD's role in biofilm-associated infections:

  • Structural biology breakthroughs:

    • Cryo-EM structures of the complete Ica complex

    • Molecular dynamics simulations of IcaD in membrane environments

    • NMR studies of specific functional domains

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to understand IcaD in the broader biofilm context

    • Network analysis of IcaD interactions across different growth phases

    • Comparative studies across diverse clinical isolates

  • Translational research opportunities:

    • Development of IcaD-targeting antimicrobial peptides

    • Small molecule inhibitors of IcaD-IcaA interactions

    • Vaccine approaches targeting surface-exposed IcaD epitopes

  • Ecological and evolutionary perspectives:

    • Investigating the role of IcaD in S. epidermidis adaptation to different human skin microenvironments

    • Understanding the evolutionary pressures shaping IcaD function

    • Exploring the distribution and variation of icaD across commensal and pathogenic strains

  • Host-pathogen interaction studies:

    • Examining how host immune factors influence IcaD expression

    • Investigating IcaD-dependent biofilm interactions with host cells

    • Understanding how medical device surfaces influence IcaD expression and function

These research directions represent valuable opportunities for researchers seeking to make significant contributions to the field. Collaborative approaches combining expertise in structural biology, microbiology, immunology, and clinical research will likely be most productive in advancing our understanding of this important virulence factor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.