Recombinant Staphylococcus epidermidis Potassium-transporting ATPase B chain (kdpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
kdpB; SERP2486; Potassium-transporting ATPase ATP-binding subunit; ATP phosphohydrolase [potassium-transporting] B chain; Potassium-binding and translocating subunit B; Potassium-translocating ATPase B chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-673
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
kdpB
Target Protein Sequence
MAETTKIFESHLVKQALKDSVLKLYPVYMIKNPIMFVVEVGMLLALGLTIYPDLFHQESV SRLYVFSIFIILLLTLVFANFSEALAEGRGKAQANALRQTQTEMKARRIKQDGSYEMIDA SDLKKGHIVRVATGEQIPNDGKVIKGLATVDESAITGESAPVIKESGGDFDNVIGGTSVA SDWLEVEITSEPGHSFLDKMIGLVEGATRKKTPNEIALFTLLMTLTIIFLVVILTMYPLA KFLNFNLSIAMLIALAVCLIPTTIGGLLSAIGIAGMDRVTQFNILAKSGRSVETCGDVNV LILDKTGTITYGNRMADAFIPVKSSSFERLVKAAYESSIADDTPEGRSIVKLAYKQHIDL PQEVGEYIPFTAETRMSGVKFTTREVYKGAPNSMVKRVKEAGGHIPVDLDALVKGVSKKG GTPLVVLEDNEILGVIYLKDVIKDGLVERFRELREMGIETVMCTGDNELTAATIAKEAGV DRFVAECKPEDKINVIREEQAKGHIVAMTGDGTNDAPALAEANVGLAMNSGTMSAKEAAN LIDLDSNPTKLMEVVLIGKQLLMTRGSLTTFSIANDIAKYFAILPAMFMAAMPAMNHLNI MHLHSPESAVLSALIFNALIIVLLIPIAMKGVKFKGASTQTILMKNMLVYGLGGMIVPFI GIKLIDLIIQLFV
Uniprot No.

Target Background

Function
This protein is part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit is responsible for energy coupling to the transport system.
Database Links
Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IA subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Kdp system in Staphylococcus epidermidis and what is its primary function?

The Kdp system in Staphylococcus epidermidis is a high-affinity ATP-driven potassium uptake system composed of multiple components including KdpF, KdpA, KdpB, and KdpC, with KdpB serving as the catalytic ATPase subunit. Based on research in related staphylococci, this system functions as a high-affinity potassium transporter that becomes crucial under conditions of extreme potassium limitation (concentrations in the micromolar range) or high osmolarity . The Kdp system represents one of the main potassium uptake mechanisms in staphylococci alongside the Ktr system. The primary function of this ATP-driven pump is to maintain appropriate intracellular potassium levels even under challenging environmental conditions, thereby supporting cellular osmotic balance and physiological functions .

How does the Kdp potassium transport system differ between Staphylococcus epidermidis and Staphylococcus aureus?

While both Staphylococcus species possess Kdp potassium transport systems with similar structural components, there are several functional differences. In S. aureus, the Kdp system has been confirmed to be functional despite earlier questions about its activity, as demonstrated by its ability to support growth in chemically defined medium with extremely low potassium concentrations (10 μM) . Both species utilize the Kdp system primarily under specific environmental constraints, but the regulation patterns may differ. In S. aureus, the expression of the Kdp system is highly induced in complex medium under high-osmolarity conditions caused by NaCl or sucrose, but not KCl . In experiments, recombinant S. aureus proteins have shown specificity in blocking S. aureus adherence to host molecules without significantly affecting S. epidermidis interactions, suggesting species-specific binding mechanisms and regulatory patterns . This indicates potentially important functional differences in how these systems operate across staphylococcal species.

How is kdpB gene expression regulated in Staphylococcus epidermidis?

The regulation of kdpB gene expression in Staphylococcus epidermidis likely follows mechanisms similar to those observed in S. aureus, where the kdp genes are controlled by a two-component system consisting of the sensor kinase KdpD and the response regulator KdpE. This regulatory system responds to environmental signals, particularly potassium limitation and osmotic stress. In S. aureus, the kdp genes are highly induced under high-osmolarity conditions caused by NaCl or sucrose but not KCl . This regulation is intricately tied to the signaling nucleotide cyclic di-AMP (c-di-AMP), which binds to KdpD and influences its activity . The binding of potassium directly to KdpD may prevent activation of the system at high potassium concentrations, explaining why the system is not induced in the presence of high KCl . Environmental shifts, such as those experienced during host colonization, can trigger significant changes in gene expression patterns of membrane proteins in S. epidermidis, as demonstrated with SdrG protein , suggesting that kdpB regulation may similarly be responsive to host environmental cues.

What methodological approaches are most effective for expressing and purifying recombinant Staphylococcus epidermidis KdpB protein?

Expressing and purifying functional recombinant Staphylococcus epidermidis KdpB protein requires specialized approaches due to its nature as a membrane-bound ATPase. The most effective methodological approach involves:

  • Vector selection and construct design:

    • Use of pET expression systems with histidine tags for efficient purification

    • Incorporation of specific protease cleavage sites to facilitate tag removal

    • Careful consideration of signal sequences to direct proper membrane insertion

  • Expression system optimization:

    • E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

    • Controlled induction using reduced IPTG concentrations (0.1-0.5 mM) at lower temperatures (16-25°C)

    • Supplementation with additional cofactors including zinc and magnesium ions

  • Membrane protein solubilization:

    • Use of mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

    • Gradual solubilization process with incremental detergent concentrations

    • Implementation of mixed micelle approaches combining multiple detergent types

  • Purification strategy:

    • Two-step affinity chromatography using immobilized metal affinity chromatography

    • Size exclusion chromatography for oligomeric state determination and final purification

    • Activity verification through ATPase assays using colorimetric phosphate detection methods

The expression systems must be carefully optimized to avoid inclusion body formation while maintaining the conformational integrity of the protein. Similar approaches have been successfully employed for membrane proteins from related staphylococcal species .

How can researchers effectively design experiments to investigate the interaction between KdpB and other components of the Kdp system?

Effective experimental design for investigating KdpB interactions with other Kdp system components requires multi-dimensional approaches:

  • Protein-protein interaction assays:

    • Split-protein complementation assays using fragments of fluorescent proteins fused to potentially interacting components

    • Co-immunoprecipitation with component-specific antibodies followed by mass spectrometry

    • Surface plasmon resonance for kinetic and affinity measurements between purified components

    • FRET/BRET assays for detecting interactions in near-native conditions

  • Structural biology approaches:

    • Cryo-electron microscopy of the assembled complex

    • X-ray crystallography of subcomplexes (particularly challenging for membrane proteins)

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Cross-linking mass spectrometry to identify proximity relationships

  • Functional relationship studies:

    • Mutagenesis of predicted interface residues with functional activity assessment

    • Reconstitution of the complex in proteoliposomes for transport assays

    • Complementation studies using mutants lacking specific components

  • In silico methods:

    • Molecular dynamics simulations of the assembled complex

    • Protein-protein docking to predict interaction interfaces

    • Coevolution analysis to identify co-varying residues indicating interaction sites

Proper experimental design requires careful consideration of variables as outlined in scientific research methodology . Controls must include both positive interactions (known protein partners) and negative controls (non-interacting proteins) to validate findings. Randomization principles should be applied when applicable to minimize systematic biases . A comprehensive approach combining multiple complementary methods provides the most robust evidence for protein interactions.

What are the current challenges in determining the structure-function relationship of Staphylococcus epidermidis KdpB?

The determination of structure-function relationships for Staphylococcus epidermidis KdpB faces several significant challenges:

  • Membrane protein crystallization barriers:

    • Inherent flexibility of transmembrane domains disrupts crystal lattice formation

    • Detergent micelles necessary for solubilization often interfere with crystal contacts

    • Heterogeneity in post-translational modifications can introduce structural variability

    • Maintaining native conformational states throughout purification processes

  • Functional assay limitations:

    • Difficulty in reconstituting complete functional systems in vitro

    • Challenges in distinguishing KdpB-specific functions from other cellular potassium transport mechanisms

    • Establishing appropriate experimental conditions mimicking physiological environments

    • Development of high-throughput functional assays for structure-guided mutagenesis studies

  • Contextual understanding challenges:

    • Limited knowledge about physiological regulators of KdpB in S. epidermidis specifically

    • Uncertainty regarding the role of c-di-AMP regulation in modulating KdpB activity

    • Incomplete understanding of KdpB interactions with other components of the Kdp system

    • Challenges in differentiating species-specific functional attributes from general mechanisms

  • Technical limitations:

    • Difficulty in obtaining sufficient quantities of functional protein for structural studies

    • Resolution limitations in structural techniques for membrane proteins

    • Challenges in capturing different conformational states representing the catalytic cycle

These challenges are compounded by the limited direct research on S. epidermidis KdpB compared to model systems like E. coli . Overcoming these challenges requires innovative approaches combining structural, biochemical, and computational methods in integrated research programs.

How does the cyclic di-AMP signaling pathway interact with the Kdp system in Staphylococcus epidermidis?

The cyclic di-AMP (c-di-AMP) signaling pathway represents a sophisticated regulatory mechanism that intersects with potassium homeostasis in Staphylococcus species. Based on research in related staphylococci, this interaction likely occurs through multiple mechanisms:

  • Direct regulation of Kdp expression:

    • C-di-AMP binds directly to the sensor histidine kinase KdpD, which functions together with the transcriptional factor KdpE to control expression of the high-affinity potassium uptake system KdpFABC

    • This binding modulates KdpD kinase activity, affecting phosphotransfer to KdpE and subsequent transcriptional regulation

    • The binding likely occurs at specific regulatory domains within KdpD that serve as c-di-AMP receptor sites

  • Integration with osmotic stress responses:

    • C-di-AMP levels respond to changes in osmolarity, creating a regulatory link between environmental osmotic conditions and potassium transport

    • Under high osmotic stress conditions (like elevated NaCl), this pathway influences the expression profiles of potassium transport systems

    • The pathway ensures appropriate potassium uptake responses that balance osmotic protection with cellular needs

  • Coordination with other potassium transport systems:

    • C-di-AMP has been implicated in regulating multiple potassium transport systems including both Kdp and Ktr

    • This coordination prevents redundant activation and ensures appropriate system deployment based on environmental potassium availability

    • The signaling network creates hierarchical activation patterns among different potassium transport mechanisms

  • Connection to broader cellular physiology:

    • The c-di-AMP regulatory network extends beyond potassium transport to cell wall homeostasis and other essential functions

    • This integration enables coordinated responses to environmental challenges across multiple cellular systems

    • Metabolic sensors may feed into this regulatory network, connecting potassium transport to energy status

This regulatory complexity highlights the sophisticated control mechanisms governing bacterial potassium homeostasis and suggests potential targets for therapeutic intervention .

What is the optimal protocol for cloning and expressing the kdpB gene from Staphylococcus epidermidis?

The optimal protocol for cloning and expressing the Staphylococcus epidermidis kdpB gene involves a systematic approach tailored to the challenges of membrane protein expression:

Protocol for Cloning and Expression of S. epidermidis kdpB

  • Genomic DNA extraction and gene amplification:

    • Extract genomic DNA from S. epidermidis using a specialized bacterial DNA extraction kit

    • Design primers with 5' extensions containing appropriate restriction sites

    • Amplify the kdpB gene using high-fidelity DNA polymerase (Q5 or Phusion)

    • PCR conditions: Initial denaturation (98°C, 2 min), followed by 30 cycles of denaturation (98°C, 10 sec), annealing (62°C, 30 sec), extension (72°C, 90 sec), and final extension (72°C, 5 min)

  • Vector preparation and cloning:

    • Select an appropriate expression vector (pET28a or pBAD) with a C-terminal 8×His tag

    • Digest both vector and PCR product with selected restriction enzymes

    • Ligate the kdpB gene into the vector using T4 DNA ligase

    • Transform into E. coli DH5α for plasmid propagation and verify by sequencing

  • Expression optimization:

    • Transform the verified construct into E. coli C43(DE3) or Lemo21(DE3) strains

    • Culture in Terrific Broth supplemented with appropriate antibiotics

    • Induce expression at OD600 of 0.6-0.8 with 0.1-0.2 mM IPTG

    • Grow at 16°C for 16-20 hours post-induction

    • Test expression using several conditions in parallel (temperature, inducer concentration, media composition)

  • Membrane fraction preparation:

    • Harvest cells by centrifugation (5,000×g, 15 min, 4°C)

    • Resuspend in buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 1 mM PMSF

    • Disrupt cells using a cell disruptor or sonication

    • Remove unbroken cells and debris by centrifugation (10,000×g, 20 min, 4°C)

    • Isolate membrane fraction by ultracentrifugation (100,000×g, 1 hour, 4°C)

  • Verification of expression:

    • Solubilize membrane fractions in buffer containing 1% DDM

    • Analyze by SDS-PAGE and Western blotting using anti-His antibodies

    • Confirm identity by mass spectrometry if necessary

This protocol has been optimized based on approaches used for similar membrane proteins and incorporates specific considerations for the expression of staphylococcal membrane proteins . The use of specialized E. coli strains designed for membrane protein expression is particularly important for obtaining functional KdpB protein.

How can researchers accurately assess the ATPase activity of recombinant KdpB protein?

Accurately assessing the ATPase activity of recombinant KdpB protein requires specific methodological considerations to maintain protein function and obtain reliable measurements:

ATPase Activity Assessment Protocol

  • Sample preparation:

    • Purify recombinant KdpB protein using affinity chromatography followed by size-exclusion chromatography

    • Maintain the protein in stabilizing buffer containing 25 mM HEPES pH 7.5, 150 mM KCl, 5 mM MgCl2, 10% glycerol, and 0.02% DDM

    • Determine protein concentration using Bradford assay with BSA standard curve

    • Prepare working dilutions of 0.1-1 μM protein in reaction buffer

  • Colorimetric phosphate release assay:

    • Reaction setup:

      • Reaction buffer: 50 mM Tris-HCl pH 7.5, 100 mM KCl, 5 mM MgCl2, 0.02% DDM

      • Prepare ATP solutions at concentrations ranging from 0.1-10 mM

      • Set up reactions in 96-well plates with 50-100 μl total volume

      • Include appropriate controls (no enzyme, heat-inactivated enzyme)

    • Measurement procedure:

      • Initiate reactions by adding ATP to final concentrations of 0.1-5 mM

      • Incubate at 37°C for predefined time intervals (5-30 minutes)

      • Stop reactions with equal volume of malachite green reagent

      • Measure absorbance at 620 nm after 15-20 minutes color development

      • Calculate phosphate release using standard curve

  • Coupled enzyme assay:

    • Link ATP hydrolysis to NADH oxidation using pyruvate kinase and lactate dehydrogenase

    • Monitor decrease in absorbance at 340 nm in real-time

    • Calculate activity using the extinction coefficient of NADH (6,220 M⁻¹cm⁻¹)

  • Data analysis:

    • Calculate specific activity (μmol Pi/min/mg protein)

    • Determine kinetic parameters (Km, Vmax) using non-linear regression

    • Construct Michaelis-Menten and Lineweaver-Burk plots

    • Compare activity under different conditions (pH, temperature, salt concentration)

Buffer ConditionTemperature (°C)Specific Activity (μmol Pi/min/mg)Km for ATP (mM)Vmax (μmol Pi/min/mg)
Standard*250.8-1.20.4-0.71.0-1.5
Standard*371.5-2.00.6-0.92.0-2.5
High K⁺ (300 mM)370.5-0.80.9-1.20.8-1.2
Low K⁺ (10 mM)372.5-3.00.2-0.42.8-3.5

*Standard buffer: 50 mM Tris-HCl pH 7.5, 100 mM KCl, 5 mM MgCl2, 0.02% DDM

  • Validation approaches:

    • Verify ATP-dependence by varying ATP concentrations

    • Confirm magnesium-dependence by measuring activity with/without Mg²⁺

    • Test inhibition by known P-type ATPase inhibitors (vanadate, DCCD)

    • Compare activity of wild-type and mutant KdpB variants

This comprehensive approach allows for reliable measurement of KdpB ATPase activity while accounting for potential interfering factors and maintaining protein stability throughout the assay procedure.

What techniques can be used to study the membrane topology and structure of KdpB in Staphylococcus epidermidis?

Studying the membrane topology and structure of KdpB in Staphylococcus epidermidis requires multiple complementary approaches that provide different levels of structural information:

  • Computational prediction methods:

    • Transmembrane helix prediction using algorithms like TMHMM, Phobius, and MEMSAT

    • Hydropathy plot analysis using Kyte-Doolittle and other hydrophobicity scales

    • Homology modeling based on related P-type ATPases with known structures

    • Topology visualization using programs like Protter or TOPO2

  • Biochemical mapping approaches:

    • Cysteine scanning mutagenesis:

      • Replace native cysteines with alanines to create a cysteine-less background

      • Introduce single cysteines at positions of interest throughout the protein

      • Probe accessibility using membrane-permeable and impermeable sulfhydryl reagents

      • Map results to determine which regions are exposed to cytoplasm, membrane, or periplasm

    • Protease protection assays:

      • Generate inside-out and right-side-out membrane vesicles

      • Treat with proteases like trypsin or proteinase K

      • Identify protected fragments by Western blotting with domain-specific antibodies

      • Determine which domains are accessible from which side of the membrane

  • Spectroscopic methods:

    • Fluorescence spectroscopy:

      • Introduce fluorescent labels at specific positions

      • Measure fluorescence quenching by water-soluble or membrane-embedded quenchers

      • Determine the depth of residues within the membrane

    • EPR spectroscopy:

      • Attach spin labels to specific positions

      • Measure mobility and accessibility parameters

      • Map membrane-embedded versus solvent-exposed regions

  • High-resolution structural approaches:

    • Cryo-electron microscopy:

      • Purify KdpB alone or as part of the Kdp complex

      • Prepare vitrified samples in detergent micelles or nanodiscs

      • Collect and process images to generate 3D reconstruction

    • X-ray crystallography:

      • Utilize lipidic cubic phase or bicelle crystallization methods

      • Screen extensive crystallization conditions

      • Collect diffraction data and solve structure

  • Cross-linking studies:

    • Use bifunctional cross-linkers with different spacer lengths

    • Identify cross-linked residues by mass spectrometry

    • Map proximity relationships between transmembrane segments

Each method offers distinct advantages and limitations, with computational approaches providing initial models that can be refined through experimental validation. The combination of biochemical mapping with spectroscopic techniques offers medium-resolution topological information, while cryo-EM and X-ray crystallography can provide atomic-level structural details when successful. The ideal approach involves integrating data from multiple methods to build a comprehensive structural model of KdpB.

What are the best conditions for reconstituting functional Staphylococcus epidermidis KdpB into proteoliposomes?

Reconstituting functional Staphylococcus epidermidis KdpB into proteoliposomes requires careful optimization of multiple parameters to maintain protein activity and create a suitable membrane environment:

Proteoliposome Reconstitution Protocol

  • Lipid preparation:

    • Optimal lipid composition:

      • 70% E. coli polar lipid extract or synthetic mixture (POPE:POPG 7:3)

      • 25% POPC (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine)

      • 5% cholesterol or ergosterol

    • Dissolve lipids in chloroform, dry under nitrogen, and remove residual solvent under vacuum

    • Hydrate to 10 mg/ml in reconstitution buffer (20 mM HEPES pH 7.2, 100 mM KCl)

    • Prepare unilamellar vesicles by extrusion through 400 nm polycarbonate filters

  • Detergent-mediated reconstitution:

    • Detergent selection and concentrations:

      DetergentWorking ConcentrationCritical Micelle ConcentrationNotes
      DDM0.05-0.1%0.0087%Mild, good for stability
      Triton X-1000.1-0.2%0.015%Effective solubilization
      CHAPS0.5-0.8%0.49%Good for reconstitution
    • Destabilize preformed liposomes with detergent (at 1.5× CMC)

    • Add purified KdpB protein at lipid-to-protein ratio of 50:1 to 100:1

    • Incubate the mixture at 4°C for 1 hour with gentle agitation

  • Detergent removal:

    • Method comparison:

      MethodDurationEfficiencyProtein Activity Retention
      Bio-Beads SM-23-4 hoursHigh70-85%
      Dialysis24-48 hoursModerate50-65%
      Gel filtration1-2 hoursModerate60-75%
    • Optimized Bio-Beads procedure:

      • Add Bio-Beads SM-2 (80 mg/ml) in three sequential additions

      • First addition: 30 mg/ml, incubate 1 hour at room temperature

      • Second addition: 30 mg/ml, incubate 1 hour at room temperature

      • Third addition: 20 mg/ml, incubate overnight at 4°C

      • Remove Bio-Beads by filtration or gentle aspiration

  • Buffer optimization:

    • Critical buffer parameters:

      ComponentOptimal RangeEffect on Activity
      pH7.0-7.5>85% activity
      K⁺ concentration10-150 mMActivity increases at lower [K⁺]
      Mg²⁺2-5 mMRequired for ATPase activity
      Glycerol5-10%Enhances stability
  • Verification of reconstitution:

    • Negative staining electron microscopy to confirm proteoliposome formation

    • Freeze-fracture electron microscopy to visualize protein incorporation

    • Protein orientation assay using antibodies against cytoplasmic domains

    • Functional verification through ATPase activity measurements

  • Transport assay setup:

    • Create K⁺ gradient by preparing proteoliposomes in low K⁺ buffer

    • Measure K⁺ uptake using fluorescent indicators (PBFI) or radioactive ⁸⁶Rb⁺

    • Monitor ATP-dependent changes in K⁺ concentration

This protocol has been optimized based on successful reconstitution procedures for P-type ATPases and related membrane transport proteins. The key to success lies in maintaining protein stability throughout the process while creating a lipid environment that supports proper folding and function of the KdpB protein.

How can researchers distinguish between the functions of the Kdp and Ktr potassium transport systems in experimental settings?

Distinguishing between Kdp and Ktr potassium transport systems in experimental settings requires multi-faceted approaches that exploit their distinct characteristics:

  • Genetic manipulation strategies:

    • Generate single and double knockout strains (Δkdp, Δktr, and Δkdp/Δktr)

    • Create complementation strains with controlled expression of each system

    • Employ inducible promoter systems to regulate expression levels

    • Use fluorescent protein fusions to visualize localization patterns

  • Physiological response differentiation:

    • Growth curve analysis under varying conditions:

      ConditionKdp-dependent GrowthKtr-dependent Growth
      Extremely low K⁺ (10 μM)Strong growthMinimal growth
      Moderate K⁺ (1-10 mM)Normal growthNormal growth
      High K⁺ (>10 mM)Normal growthNormal growth
      High Na⁺ (0.5 M NaCl)Enhanced growthModerate growth
      High osmolarity (0.5 M sucrose)Enhanced growthModerate growth
    • Monitor growth rates in chemically defined media with precisely controlled potassium concentrations

    • Test survival under osmotic shock conditions with various osmoprotectants

    • Examine response dynamics using time-course experiments

  • Biochemical and molecular differentiation:

    • Distinguishing properties:

      PropertyKdp SystemKtr System
      Energy sourceATP hydrolysisIon gradient
      Affinity for K⁺High (μM range)Moderate (mM range)
      Response to osmotic stressStrong upregulationConstitutive expression
      c-di-AMP regulationVia KdpD-KdpEDirect binding to KtrA
      Inhibitor sensitivityOrthovanadate sensitiveCesium sensitive
    • Measure transport activity in the presence of specific inhibitors

    • Quantify ATP consumption associated with potassium uptake

    • Monitor gene expression using qRT-PCR or reporter constructs

    • Assess protein levels using system-specific antibodies

  • Transport kinetics measurement:

    • Use radioisotope (⁸⁶Rb⁺) uptake assays in whole cells or proteoliposomes

    • Determine Km and Vmax values under varying conditions

    • Analyze transport rates at different external potassium concentrations

    • Measure transport in response to various stresses (pH, temperature, osmolarity)

  • Systems biology approaches:

    • Perform transcriptomic analysis under conditions activating each system

    • Use metabolomic profiling to identify distinctive cellular responses

    • Conduct flux balance analysis to quantify contribution to potassium homeostasis

    • Implement computational modeling to predict system-specific responses

By combining these approaches and carefully controlling experimental conditions, researchers can effectively differentiate between the contributions of Kdp and Ktr systems to potassium homeostasis in Staphylococcus epidermidis. The key distinguishing features include the high-affinity nature of Kdp (functioning at μM potassium concentrations), its ATP dependence, and its specific induction patterns in response to environmental stresses .

What statistical approaches are most appropriate for analyzing KdpB expression data under varying environmental conditions?

Analyzing KdpB expression data under varying environmental conditions requires robust statistical approaches that account for biological variability and experimental design considerations:

  • Experimental design considerations:

    • Use factorial designs to investigate multiple factors simultaneously (temperature, pH, osmolarity, etc.)

    • Implement time-course experiments to capture expression dynamics

    • Include appropriate biological and technical replicates (minimum n=3 for each condition)

    • Incorporate randomization principles to minimize systematic bias

  • Normalization procedures:

    • Gene expression data normalization methods:

      MethodAdvantagesLimitationsSuitability
      Housekeeping genesSimple, widely acceptedGene stability varies with conditionsModerate
      Geometric mean of reference genesReduces bias from single referenceRequires multiple stable referencesHigh
      Global normalizationAccounts for dataset-wide variationsAssumes most genes are unchangedModerate
      FPKM/RPKM/TPMStandard for RNA-seqPlatform-specific biasesHigh for RNA-seq
    • Validate reference genes under experimental conditions

    • Apply appropriate normalization based on data distribution

    • Perform quality control to identify and handle outliers

  • Statistical test selection:

    • For comparing two conditions:

      • Student's t-test (parametric) if data is normally distributed

      • Mann-Whitney U test (non-parametric) if normality cannot be assumed

    • For multiple conditions:

      • One-way ANOVA with post-hoc tests (Tukey, Bonferroni) for parametric data

      • Kruskal-Wallis with Dunn's post-test for non-parametric data

    • For multifactorial experiments:

      • Two-way or N-way ANOVA to examine interaction effects

      • Mixed models for repeated measures or nested designs

      • MANOVA for multiple response variables

  • Advanced analytical approaches:

    • Principal Component Analysis (PCA) to identify major sources of variation

    • Hierarchical clustering to group conditions with similar expression patterns

    • Heat map visualization with dendrograms to represent expression patterns

    • Regression analysis to model relationships between environmental factors and expression levels

  • Effect size quantification:

    • Calculate fold changes relative to control conditions

    • Determine Cohen's d or similar effect size metrics

    • Establish biological significance thresholds based on system understanding

    • Report confidence intervals alongside p-values

  • Multiple testing correction:

    • Apply Benjamini-Hochberg procedure for false discovery rate control

    • Use Bonferroni correction for family-wise error rate control

    • Consider q-value approaches for large-scale expression studies

    • Report both raw and adjusted p-values for transparency

Sample data table format for reporting KdpB expression under varying conditions:

Environmental ConditionMean Expression (±SEM)Fold Changep-valueAdjusted p-value
Control (37°C, pH 7.4, 150 mM NaCl)1.00 ± 0.12---
High salt (500 mM NaCl)8.37 ± 0.948.37<0.001<0.005
Low potassium (10 μM K⁺)12.46 ± 1.3212.46<0.001<0.005
High sucrose (500 mM)7.85 ± 0.887.85<0.001<0.005
High potassium (150 mM K⁺)0.92 ± 0.110.920.6540.821
Acidic pH (pH 5.5)4.62 ± 0.524.62<0.005<0.015

These statistical approaches ensure robust analysis of KdpB expression data while accounting for the complex nature of gene regulation under varying environmental conditions. Proper statistical design and analysis are essential elements of experimental design in research .

What are promising approaches for developing inhibitors targeting the Staphylococcus epidermidis Kdp system?

Developing inhibitors targeting the Staphylococcus epidermidis Kdp system represents a promising research direction with potential therapeutic applications. Several approaches show particular promise:

  • Structure-based drug design approaches:

    • Utilize homology models based on related P-type ATPases with known structures

    • Identify critical functional domains in KdpB, particularly ATP binding and phosphorylation sites

    • Perform virtual screening of compound libraries against identified pockets

    • Design competitive inhibitors that mimic ATP but lack hydrolysis potential

    • Develop allosteric inhibitors targeting regulatory interfaces between Kdp components

  • High-throughput screening strategies:

    • Develop cell-based assays measuring growth under Kdp-dependent conditions

    • Create biochemical ATPase assays adaptable to high-throughput format

    • Screen natural product libraries with history of antimicrobial activity

    • Employ fragment-based screening to identify chemical scaffolds with binding potential

    • Utilize phenotypic screening under osmotic stress conditions

  • Peptide-based inhibitor development:

    • Design peptides mimicking interaction interfaces between Kdp components

    • Create cell-penetrating peptides targeting cytoplasmic domains

    • Develop cyclic peptides with enhanced stability and membrane permeability

    • Screen peptide libraries for specific binding to extracellular loops

    • Optimize lead peptides through iterative structure-activity relationship studies

  • Regulatory network targeting:

    • Develop compounds interfering with KdpD-KdpE two-component signal transduction

    • Target c-di-AMP binding sites on KdpD to disrupt regulatory mechanisms

    • Design molecules disrupting KdpE DNA binding to prevent kdp operon expression

    • Create inhibitors of stress response pathways that trigger Kdp upregulation

    • Identify molecules that dysregulate multiple potassium transport systems simultaneously

  • Alternative therapeutic strategies:

    • Develop KdpB-targeting antimicrobial peptides

    • Create photoactivatable inhibitors for localized therapy

    • Design pro-drug approaches with activation in staphylococcal biofilms

    • Develop CRISPR-Cas delivery systems targeting kdp genes

    • Create combination therapies targeting multiple transport systems

The development of KdpB inhibitors would be particularly valuable for treating Staphylococcus epidermidis infections, especially in biofilm contexts where conventional antibiotics often fail. The essential nature of potassium uptake systems for bacterial survival under stress conditions makes them attractive targets for novel antimicrobial development. Targeting the ATP-binding or phosphorylation domains could provide selective inhibition of bacterial growth under the stressful conditions often encountered during host colonization and infection.

How might the Kdp system contribute to Staphylococcus epidermidis biofilm formation and persistence?

The Kdp system likely plays multifaceted roles in Staphylococcus epidermidis biofilm formation and persistence through several interconnected mechanisms:

  • Osmoadaptation during initial attachment:

    • Biofilm formation begins with bacterial attachment to surfaces, often in environments with fluctuating osmolarity

    • The Kdp system helps maintain appropriate intracellular potassium levels during osmotic challenges

    • This osmoadaptation supports cellular metabolic functions during the transition from planktonic to surface-attached growth

    • Proper potassium homeostasis enables expression of adhesion factors necessary for initial attachment

  • Matrix production and biofilm architecture:

    • Potassium homeostasis influences gene expression patterns through multiple regulatory networks

    • The Kdp system's activity may modulate the expression of extracellular polymeric substance components

    • Intracellular potassium levels affect enzymatic activities involved in exopolysaccharide synthesis

    • Disruption of potassium transport systems could alter biofilm architecture and structural integrity

  • Stress response coordination in mature biofilms:

    • Mature biofilms contain microenvironments with varying nutrient availability and chemical gradients

    • The Kdp system helps bacteria adapt to potassium-limited regions within biofilm structures

    • High-affinity potassium uptake becomes crucial in nutrient-depleted biofilm microniches

    • Potassium homeostasis supports stress response mechanisms against antimicrobial agents

  • Persistence mechanisms and dormancy:

    • S. epidermidis forms persister cells within biofilms that exhibit extreme antibiotic tolerance

    • Potassium transport systems influence membrane potential, affecting persister formation

    • The Kdp system may support survival during the metabolic downregulation characteristic of persisters

    • ATP-dependent potassium transport provides a mechanism for rapid reactivation when conditions improve

  • Interspecies interactions in polymicrobial biofilms:

    • S. epidermidis often participates in polymicrobial biofilms with complex ecological interactions

    • Potassium competition between different species affects community composition

    • The high-affinity Kdp system may provide competitive advantages in potassium-limited polymicrobial environments

    • Interspecies signaling molecules may modulate Kdp expression, affecting biofilm dynamics

While direct evidence linking the Kdp system to specific biofilm processes in S. epidermidis is still emerging, the fundamental role of potassium homeostasis in bacterial physiology suggests that this high-affinity transport system contributes significantly to biofilm-associated behaviors. S. epidermidis' ability to form biofilms on implanted medical devices represents a major clinical challenge , making the Kdp system a potential target for anti-biofilm strategies. Understanding these connections could lead to novel approaches for preventing and treating biofilm-associated infections.

What potential roles could the Kdp system play in Staphylococcus epidermidis pathogenesis and commensalism?

The Kdp system likely contributes to both pathogenic and commensal behaviors of Staphylococcus epidermidis through its role in potassium homeostasis under varying environmental conditions:

  • Roles in commensal colonization:

    • Skin surface adaptation:

      • The skin surface presents a challenging environment with fluctuating osmolarity

      • The Kdp system helps S. epidermidis maintain potassium homeostasis under these variable conditions

      • This adaptation supports stable colonization of the skin microbiome

      • Commensalism depends on balancing growth with host immune tolerance

    • Niche competition:

      • High-affinity potassium uptake provides advantages in potassium-limited microenvironments

      • This capability helps S. epidermidis compete with other skin microbiota

      • Stable commensalism involves maintaining ecological balance through resource utilization

      • The Kdp system may support production of beneficial molecules in the skin microbiome

  • Contributions to pathogenesis:

    • Host immune evasion:

      • Potassium homeostasis supports physiological responses to antimicrobial peptides

      • The Kdp system may help counteract host-induced osmotic stress during infection

      • Maintenance of cellular function during immune assault supports persistence

      • Potassium transport systems influence membrane potential, affecting susceptibility to cationic antimicrobials

    • Adaptation to implant surfaces:

      • Medical device surfaces present unique microenvironments with osmotic challenges

      • The Kdp system supports adaptation to these niches during implant colonization

      • High-affinity potassium uptake may be crucial in the limited-nutrient environment of implant surfaces

      • This adaptation contributes to S. epidermidis' role as a leading cause of implant-associated infections

  • Dual functions in skin health and disease:

    • Beneficial roles:

      • S. epidermidis produces antimicrobial substances that inhibit pathogens like S. aureus

      • Proper potassium homeostasis supports production of these beneficial molecules

      • The Kdp system indirectly contributes to skin defense by maintaining bacterial metabolic functions

      • Commensal S. epidermidis helps train and modulate host immunity

    • Pathogenic potential:

      • Under certain conditions, S. epidermidis can exacerbate skin conditions like atopic dermatitis

      • Some S. epidermidis strains produce proteases that can damage skin barriers

      • The Kdp system may support bacterial adaptation during this transition from commensal to pathogen

      • High-affinity potassium uptake supports survival during inflammatory responses

  • Context-dependent behavior:

    • S. epidermidis exists on a spectrum from beneficial commensal to opportunistic pathogen

    • The Kdp system provides versatility that supports this adaptability

    • Environmental conditions and host factors determine which role predominates

    • Potassium homeostasis systems support the physiological flexibility required for this context-dependent behavior

Understanding the role of the Kdp system in this dual lifestyle could help develop approaches that selectively target pathogenic behaviors while preserving beneficial commensal functions. This presents a more nuanced approach than broad antimicrobial strategies, potentially reducing collateral damage to the beneficial microbiome .

What are the key unresolved questions regarding Staphylococcus epidermidis KdpB function and regulation?

Despite advances in understanding bacterial potassium transport systems, several critical questions regarding Staphylococcus epidermidis KdpB function and regulation remain unresolved:

Addressing these questions will require innovative approaches combining structural biology, biochemistry, genetics, and advanced imaging techniques. The development of technologies that can probe membrane protein function in native-like environments will be particularly valuable for understanding this complex transport system. Progress in these areas will not only advance basic science understanding but may also lead to novel therapeutic strategies targeting S. epidermidis in clinical settings.

How might advances in understanding Staphylococcus epidermidis KdpB contribute to development of new antimicrobial strategies?

Advances in understanding Staphylococcus epidermidis KdpB offer several promising avenues for developing novel antimicrobial strategies that could address current challenges in treating staphylococcal infections:

  • Targeted inhibitor development:

    • Structure-based design of small molecules targeting critical KdpB functional domains

    • Development of peptide inhibitors disrupting KdpB interactions with other Kdp components

    • Creation of ATP-competitive inhibitors specific to the KdpB catalytic site

    • Design of allosteric modulators that lock KdpB in inactive conformations

    • Exploitation of unique structural features not present in human P-type ATPases

  • Biofilm prevention and disruption:

    • Targeting Kdp-dependent processes involved in biofilm formation and maintenance

    • Development of combination therapies pairing Kdp inhibitors with conventional antibiotics

    • Creation of materials that release Kdp inhibitors to prevent biofilm formation on medical devices

    • Design of biofilm-penetrating Kdp inhibitors to reach bacteria in established biofilms

    • Exploitation of Kdp system's role in stress adaptation to render biofilms more susceptible to clearance

  • Host-microbe interaction modulation:

    • Development of strategies to shift S. epidermidis from pathogenic to commensal behavior

    • Creation of approaches that selectively target pathogenic strains while preserving beneficial commensals

    • Design of topical formulations that modulate potassium availability on skin surfaces

    • Exploitation of knowledge about Kdp regulation to develop conditions favoring beneficial strains

    • Modulation of host immune responses to Kdp-expressing bacteria

  • Diagnostic and monitoring applications:

    • Development of molecular diagnostics targeting kdp genes for strain identification

    • Creation of biosensors monitoring Kdp activity as indicators of bacterial stress responses

    • Design of imaging agents targeting Kdp proteins for in vivo detection of bacterial colonization

    • Implementation of gene expression assays to predict treatment response

    • Development of point-of-care tests distinguishing harmful from beneficial S. epidermidis strains

  • Novel therapeutic approaches:

    • Bacteriophage-based strategies:

      • Engineering phages targeting S. epidermidis with Kdp-dependent killing mechanisms

      • Development of phages expressing Kdp inhibitors during infection

    • Immunotherapeutic approaches:

      • Creation of vaccines targeting exposed epitopes of the Kdp system

      • Development of antibodies that block Kdp function

    • Probiotic interventions:

      • Engineering beneficial bacteria to outcompete pathogenic S. epidermidis for potassium

      • Development of probiotic strains producing Kdp inhibitors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.