Recombinant Staphylococcus epidermidis Probable CtpA-like serine protease (SE_1113)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
SE_1113; Probable CtpA-like serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-491
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 12228)
Target Names
SE_1113
Target Protein Sequence
MNDHQKNHATSQDDNTKSTPSKNSKHIKIKLWHFILVILGIILLTSIITVVSTILISHQK SGLNKEQRANLKKIEYVYQTLNKDYYKKQSSDKLTQSAIDGMVKELKDPYSEYMTAEETK QFNEGVSGDFVGIGAEMQKKNEQISVTSPMKDSPAEKAGIQPKDIVTQVNHHSVVGKPLD QVVKMVRGKKGTYVTLTIKRGSQEKDIKIKRDTIHVKSVEYEKKGNVGVLTINKFQSNTS GELKSAIIKAHKQGIRHIILDLRNNPGGLLDEAVKMANIFIDKGNTVVQLEKGKDKEELK TSNQALKQAKDMKVSILVNEGSASASEVFTGAMKDYHKAKVYGSKTFGKGIVQTTREFSD GSLIKYTEMKWLTPDGHYIHGKGIRPDVSISTPKYQSLNVIPDNKTYHQGEKDKNVKTMK IGLKALGYPIDNETNIFDEQLESAIKTFQQDNNLKVNGNFDKKTNDKFTEKLVEKANKKD TVLNDLLNKLK
Uniprot No.

Target Background

Database Links

KEGG: sep:SE1113

STRING: 176280.SE1113

Protein Families
Peptidase S41A family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the functional importance of CtpA-like serine proteases in bacterial systems?

CtpA-like serine proteases function as carboxyl-terminal processing proteases that play crucial roles in bacterial signal transduction pathways. In Gram-negative bacteria such as Pseudomonas, these periplasmic proteases modulate cell-surface signaling (CSS) activity by participating in the regulated proteolysis of anti-σ factors associated with extracytoplasmic function σ factors (σECF) . This proteolytic cascade enables bacteria to respond to extracellular signals by activating specific transcriptional programs. While most research has focused on Gram-negative systems, homologous proteases in Gram-positive bacteria like S. epidermidis likely serve related functions in proteolytic processing and cellular signaling, though through different molecular mechanisms due to their distinct cell envelope architecture.

How does SE_1113 structurally compare to other bacterial CtpA proteases?

The SE_1113 protein represents a probable CtpA-like serine protease from S. epidermidis with conserved catalytic domains characteristic of carboxyl-terminal processing proteases. While specific structural data for SE_1113 is limited, comparative analysis with other bacterial CtpA proteins reveals commonalities in the catalytic triad typical of serine proteases. Unlike the CtpA from Pseudomonas, which functions in the periplasm of these Gram-negative bacteria , SE_1113 would operate in the different cellular environment of Gram-positive S. epidermidis. The functional domains likely include an active site domain containing the catalytic residues and substrate recognition regions that determine specificity.

What methodological approaches enable identification of CtpA substrates?

To identify physiological substrates of the SE_1113 protease, researchers should implement a multi-faceted approach:

  • Comparative Proteomics: Analyze protein profiles from wild-type S. epidermidis versus SE_1113 knockout strains using mass spectrometry to identify accumulating unprocessed proteins.

  • Substrate Trapping: Create catalytically inactive SE_1113 variants through site-directed mutagenesis of the active site residues, enabling the capture of substrate proteins that bind but cannot be processed.

  • In vitro Cleavage Assays: Test candidate substrates identified through bioinformatic prediction against purified recombinant SE_1113, monitoring proteolytic activity through SDS-PAGE or mass spectrometry.

  • Transcriptional Profiling: Compare gene expression patterns between wild-type and SE_1113-deficient strains to identify signaling pathways affected by the absence of this protease activity.

When analyzing results, researchers should focus on proteins showing consistent processing defects across multiple experimental approaches, as these represent the most likely physiological substrates.

What are the optimal conditions for expressing recombinant SE_1113 in laboratory settings?

The optimal expression conditions for recombinant SE_1113 should consider several key parameters that maximize protein yield while maintaining enzymatic activity:

ParameterRecommended ConditionRationale
Expression SystemE. coli BL21(DE3)Suppressed protease activity, high yield
Induction Temperature18-22°CReduces inclusion body formation
Induction Time16-18 hoursAllows slow accumulation of properly folded protein
IPTG Concentration0.1-0.5 mMLower concentration reduces toxicity
Media Supplementation1% glucose, 5-10 mM MgSO₄Stabilizes plasmid, enhances proper folding
Fusion TagsN-terminal His₆ tag with TEV cleavage siteFacilitates purification with minimal impact on activity

The experimental design should include proper controls to verify protease activity after expression and purification . A temperature optimization study is particularly important as serine proteases often show temperature-dependent activity profiles. Researchers should validate expression through Western blotting before scaling up production.

How can researchers accurately measure the enzymatic activity of SE_1113?

To quantitatively assess SE_1113 activity, researchers should employ a multi-method approach:

  • Fluorogenic Peptide Substrates: Design peptides containing a C-terminal fluorophore quenched by a proximal quencher that becomes fluorescent upon cleavage. Monitor reaction kinetics using a fluorescence plate reader at optimal excitation/emission wavelengths.

  • Gel-based Activity Assays: For qualitative assessment, incorporate SE_1113 into polyacrylamide gels containing gelatin or collagen, similar to methods used for other S. epidermidis proteases . After electrophoresis and incubation, stain gels to visualize zones of proteolytic activity.

  • Mass Spectrometry Validation: For definitive substrate identification and cleavage site mapping, analyze the reaction products using LC-MS/MS to determine the exact position of proteolytic processing.

For consistent results, standardize buffer conditions (pH 7.0-8.0, 150 mM NaCl, 5 mM CaCl₂) and establish a dose-response curve using a known substrate to determine the linear range of the assay. Activity should be reported in enzyme units, defining one unit as the amount of enzyme required to cleave a specified quantity of substrate under standard conditions within a defined time period.

What controls are essential when studying SE_1113 function in S. epidermidis?

When investigating SE_1113 function in S. epidermidis, the following controls are essential for robust experimental design:

  • Genetic Controls:

    • Wild-type parent strain (positive control)

    • SE_1113 gene deletion mutant (ΔSE_1113)

    • Complemented mutant expressing the wild-type SE_1113 gene

    • Catalytic-dead mutant expressing SE_1113 with point mutations in the catalytic triad

  • Phenotypic Controls:

    • Growth curves in standard and stress conditions to assess general fitness

    • Comparison with other protease mutants (e.g., in EcpA) to distinguish specific from general protease effects

  • Experimental Design Controls:

    • Include technical and biological replicates (minimum n=3)

    • Perform experiments under both inducing and non-inducing conditions

    • Include time course analyses to capture dynamic processes

  • Quantification Controls:

    • Standard curves for all quantitative measurements

    • Internal normalization controls for RNA and protein analyses

    • Appropriate statistical tests with correction for multiple comparisons

This comprehensive approach minimizes confounding variables and strengthens causal relationships between SE_1113 activity and observed phenotypes . When reporting results, researchers should clearly document all control data alongside experimental findings.

How does SE_1113 contribute to S. epidermidis virulence mechanisms?

Based on research with homologous proteases, SE_1113 likely contributes to S. epidermidis virulence through several mechanisms:

  • Protein Maturation: SE_1113 may process virulence factors to their active forms, similar to how other bacterial proteases activate toxins or adhesins. This processing step could be critical for the function of various extracellular and surface-associated proteins.

  • Stress Response Regulation: By analogy to CtpA in other bacteria, SE_1113 might regulate stress response pathways that enable S. epidermidis to withstand host defense mechanisms. In Pseudomonas, CtpA influences cell-surface signaling systems that are crucial for adaptation to environmental changes .

  • Immune Evasion: The protease activity could degrade host defense proteins or modify bacterial surface proteins to evade immune recognition. Studies with other S. epidermidis proteases like EcpA have shown they can alter skin integrity, triggering inflammation and disrupting the skin physical barrier .

  • Biofilm Formation: SE_1113 may process proteins involved in biofilm formation, which is a key virulence trait of S. epidermidis in medical device-associated infections. Proper proteolytic processing often regulates the transition between planktonic and biofilm growth states.

While direct evidence for SE_1113's role is still emerging, studies of the CtpA protease in Pseudomonas aeruginosa have demonstrated that mutation of the ctpA gene decreases virulence in both zebrafish embryo and human lung epithelial cell infection models . This suggests that SE_1113 may similarly influence S. epidermidis pathogenicity.

What is the relationship between SE_1113 expression and host-pathogen interactions?

The expression of SE_1113 likely responds to specific environmental cues during host-pathogen interactions. While direct data for SE_1113 is limited, research on related proteases suggests several important patterns:

  • Environmental Regulation: Expression may be upregulated in response to specific host environments, similar to how proteases in S. epidermidis isolates from atopic dermatitis skin show increased expression compared to those from healthy skin .

  • Tissue-Specific Patterns: The protease expression may vary depending on the colonization site. For example, when testing S. epidermidis strains on human skin equivalent models, protease activity varied significantly between isolates from different skin conditions .

  • Temporal Dynamics: SE_1113 expression might follow temporal patterns during infection progression, with different expression levels during initial colonization versus established infection.

A Human Skin Equivalent (HSE) model study with various S. epidermidis isolates showed that strains from atopic dermatitis lesional skin exhibited significantly higher protease activity than isolates from healthy skin . While this study focused on another protease (EcpA), similar expression patterns might apply to SE_1113, suggesting that protease expression correlates with the pathogenic potential of the strain.

How do mutations in the SE_1113 gene affect S. epidermidis phenotypes?

Mutations in the SE_1113 gene would likely produce several measurable phenotypic changes:

  • Altered Protein Processing: Accumulation of unprocessed protein substrates, potentially affecting multiple cellular functions depending on the specific substrates involved.

  • Modified Stress Response: Based on studies of CtpA in Pseudomonas, SE_1113 mutants may show altered responses to environmental stressors like antimicrobial peptides, oxidative stress, or nutrient limitation .

  • Virulence Attenuation: Similar to how ctpA mutants in P. aeruginosa show decreased virulence , SE_1113 mutants might exhibit reduced pathogenicity in infection models.

  • Cell Envelope Alterations: Potential changes in cell surface properties, possibly affecting biofilm formation, adhesion to host tissues, or interaction with the immune system.

Experimental evidence from Pseudomonas shows that ctpA mutants have decreased activity in cell-surface signaling pathways and reduced virulence in both zebrafish embryos and lung epithelial cell infection models . The attenuation in virulence suggests that CtpA proteases play important roles in bacterial pathogenesis across different species, and similar effects might be observed in S. epidermidis SE_1113 mutants.

How does SE_1113 function differ from CtpA proteases in Gram-negative bacteria?

SE_1113 from S. epidermidis and CtpA proteases from Gram-negative bacteria like Pseudomonas aeruginosa share a common enzymatic function as carboxyl-terminal processing proteases but operate in significantly different cellular contexts:

FeatureSE_1113 (S. epidermidis)CtpA (P. aeruginosa)
Cellular LocalizationAssociated with cell membrane or secreted (Gram-positive)Periplasmic (Gram-negative)
Signaling SystemUnknown, likely different from CSSFunctions in Cell-Surface Signaling (CSS)
Proteolytic CascadeIndependent operatorWorks in cascade with Prc and RseP proteases
Substrate RangeLikely processes surface proteinsPrevents Prc-mediated proteolysis of anti-σ factors
Structural EnvironmentFunctions in cell wall-associated spaceFunctions in periplasmic space between membranes

In P. aeruginosa, CtpA functions upstream of the Prc protease in a proteolytic cascade that regulates cell-surface signaling by preventing Prc-mediated proteolysis of anti-σ factors . Since S. epidermidis lacks a periplasmic space and the CSS system, SE_1113 must function in a different regulatory context, potentially processing surface proteins directly involved in host interactions or biofilm formation.

What evolutionary relationships exist between bacterial carboxyl-terminal processing proteases?

Carboxyl-terminal processing proteases represent an ancient and conserved family of enzymes that have evolved specific functions across different bacterial species:

  • Core Conservation: The catalytic domain containing the serine protease active site shows high sequence conservation across diverse bacterial phyla, suggesting an essential function maintained throughout evolution.

  • Functional Divergence: Despite conserved catalytic mechanisms, these proteases have evolved to process different substrates and participate in distinct cellular pathways. In Pseudomonas, CtpA modulates cell-surface signaling , while in other bacteria, homologous enzymes may process different substrates.

  • Phylogenetic Distribution: CtpA-like proteases are widely distributed across both Gram-positive and Gram-negative bacteria, indicating their origin predates the divergence of these bacterial groups.

  • Domain Architecture: Variations in non-catalytic domains reflect adaptation to different cellular environments and substrate recognition requirements. These adaptations likely enable the proteases to function effectively in their specific cellular contexts.

The evolutionary specialization of these proteases across bacterial species makes them interesting targets for studying bacterial adaptation to different ecological niches, including host environments for pathogenic species like S. epidermidis.

What structural features determine SE_1113 substrate specificity?

The substrate specificity of SE_1113 likely depends on several key structural features:

  • Active Site Architecture: The configuration of the catalytic triad (typically Ser-His-Asp in serine proteases) determines the basic cleavage chemistry, while surrounding residues create a microenvironment that influences which peptide bonds can be cleaved.

  • Substrate Binding Pockets: Specialized binding pockets accommodate specific amino acid side chains of the substrate, with the S1 pocket primarily determining the preference for amino acids at the P1 position (just before the cleavage site).

  • Recognition Domains: Additional domains or surface features outside the catalytic site may interact with extended regions of substrate proteins, conferring specificity beyond the immediate cleavage site.

  • Regulatory Elements: Structural elements that respond to environmental signals (pH, ions, etc.) may alter the conformation of the protease, thereby modulating its activity and specificity under different conditions.

A detailed structural analysis using techniques such as X-ray crystallography or cryo-electron microscopy would be necessary to fully characterize these features in SE_1113. Computational modeling based on homology to better-characterized CtpA structures could provide preliminary insights into the structural basis of substrate recognition.

What approaches can be used to develop specific inhibitors for SE_1113?

Developing specific inhibitors for SE_1113 requires a structured drug discovery approach:

  • Structure-Based Design:

    • Determine the crystal structure of SE_1113 through X-ray crystallography or use homology modeling based on related proteases

    • Perform in silico docking studies to identify compounds that bind the active site

    • Design transition-state analogs that mimic the substrate during catalysis

  • High-Throughput Screening:

    • Develop a fluorescence-based assay using synthetic peptide substrates

    • Screen diverse chemical libraries for compounds that inhibit SE_1113 activity

    • Perform counter-screening against other serine proteases to identify selective inhibitors

  • Peptide-Based Inhibitors:

    • Design peptides mimicking natural substrates with modifications at the cleavage site

    • Incorporate non-hydrolyzable bonds or reactive groups to create mechanism-based inhibitors

    • Optimize using structure-activity relationship studies

  • Validation and Optimization:

    • Test promising candidates in cellular models of S. epidermidis infection

    • Assess inhibition specificity using proteomic approaches

    • Optimize pharmacokinetic properties while maintaining selectivity

Target selectivity is crucial to avoid off-target effects on host proteases or beneficial microbiota. The inhibitor development process should include careful assessment of specificity using panels of human serine proteases and those from commensal bacteria.

How can proteomics approaches be applied to identify the complete substrate profile of SE_1113?

To comprehensively identify SE_1113 substrates, researchers should implement an integrated proteomics workflow:

  • TAILS (Terminal Amine Isotopic Labeling of Substrates):

    • This negative selection approach enriches for protein N-termini and proteolytically generated neo-N-termini

    • Compare samples from wild-type S. epidermidis with SE_1113 knockout strains

    • Identify differential N-terminal peptides that represent potential SE_1113 cleavage products

  • SILAC (Stable Isotope Labeling with Amino acids in Cell culture):

    • Label wild-type and SE_1113 mutant bacteria with different isotopes

    • Mix samples and analyze by LC-MS/MS to quantify protein abundance changes

    • Identify accumulating unprocessed proteins in the mutant strain

  • Degradomics Approach:

    • Use biotinylated activity-based probes specific for serine proteases

    • Identify proteins that interact directly with SE_1113

    • Distinguish between substrates and interacting partners through competition assays

  • Bioinformatic Analysis:

    • Analyze identified potential substrates for common sequence motifs

    • Predict additional substrates based on established cleavage site preferences

    • Validate predictions through targeted proteomics

This multi-method approach allows for cross-validation of results and minimizes false positives. The complete substrate profile will provide insights into the cellular pathways regulated by SE_1113 and potential intervention points for therapeutic development.

What are the challenges in translating in vitro findings about SE_1113 to in vivo infection models?

Translating in vitro findings about SE_1113 to relevant in vivo models presents several significant challenges:

  • Environmental Complexity:

    • In vitro conditions fail to replicate the complex host environment

    • Factors like pH, nutrient availability, and immune components may alter SE_1113 expression and activity

    • Solution: Develop stratified ex vivo models like human skin equivalents that better mimic the infection environment

  • Temporal Dynamics:

    • Infection is a dynamic process while many in vitro studies provide static snapshots

    • SE_1113 function may vary at different infection stages

    • Solution: Implement time-course studies with sampling at multiple infection stages

  • Host-Pathogen Interactions:

    • In vitro studies often exclude host factors that may influence SE_1113 activity

    • Immune responses may modulate protease expression and function

    • Solution: Use co-culture systems with relevant host cells or ex vivo tissue models

  • Strain Variation:

    • Laboratory-adapted strains may differ from clinical isolates

    • SE_1113 expression and activity may vary among S. epidermidis strains

    • Solution: Include multiple clinical isolates from different sources in the analysis

  • Experimental Design Limitations:

    • Appropriate controls are essential but often challenging to implement in complex models

    • Variables must be controlled while maintaining physiological relevance

    • Solution: Employ factorial experimental designs to systematically evaluate multiple variables

Addressing these challenges requires an integrated approach that gradually increases model complexity from in vitro to ex vivo to in vivo, with appropriate controls and validation at each stage. The use of human skin equivalent models has proven valuable for studying S. epidermidis proteases and could be adapted specifically for SE_1113 functional studies.

What are the most promising therapeutic applications targeting SE_1113?

SE_1113 represents a potential therapeutic target with several promising applications:

  • Anti-virulence Therapy: Specific inhibitors of SE_1113 could attenuate S. epidermidis virulence without directly killing the bacteria, potentially reducing selective pressure for resistance. This approach is supported by findings that ctpA mutation decreases virulence in P. aeruginosa , suggesting similar effects might occur in S. epidermidis.

  • Biofilm Prevention: If SE_1113 is involved in biofilm formation, inhibitors could prevent device-associated infections by blocking this critical virulence mechanism. This would be particularly valuable for implanted medical devices where S. epidermidis biofilms pose significant clinical challenges.

  • Combinatorial Approaches: SE_1113 inhibitors could sensitize resistant S. epidermidis to conventional antibiotics by disrupting stress response mechanisms, similar to how protease inhibitors can enhance antibiotic efficacy in other bacterial systems.

  • Diagnostic Markers: Detection of SE_1113 activity could serve as a biomarker for virulent S. epidermidis strains, helping distinguish between commensal colonization and pathogenic infection. This distinction is clinically important given S. epidermidis's dual nature as both commensal and opportunistic pathogen.

Therapeutic development should focus on selective inhibition to avoid disrupting beneficial microbiota or host proteases. The extensive role of CtpA proteases in bacterial virulence suggests that targeting SE_1113 could be a viable approach for managing S. epidermidis infections, particularly in biofilm-associated device infections.

How might CRISPR-Cas technologies enhance functional studies of SE_1113?

CRISPR-Cas technologies offer powerful approaches for studying SE_1113 function:

  • Precise Gene Editing:

    • Create clean gene deletions without polar effects on adjacent genes

    • Introduce point mutations to study specific functional domains (e.g., catalytic residues)

    • Generate tagged versions of SE_1113 for localization and interaction studies

  • Regulated Expression Systems:

    • Implement CRISPRi (CRISPR interference) to achieve tunable repression of SE_1113

    • Develop CRISPRa (CRISPR activation) systems to upregulate expression under controlled conditions

    • Create inducible systems to study temporal aspects of SE_1113 function

  • High-Throughput Functional Genomics:

    • Conduct CRISPR screens to identify genetic interactions with SE_1113

    • Identify synthetic lethal interactions that could suggest novel combination therapies

    • Map the genetic network surrounding SE_1113 function

  • In vivo Applications:

    • Develop CRISPR-based systems for studying SE_1113 directly in infection models

    • Create reporter systems linked to SE_1113 activity for real-time monitoring

    • Implement CRISPR delivery systems that function during infection

The implementation of these technologies would significantly accelerate our understanding of SE_1113 function and potentially reveal new therapeutic strategies. The ability to precisely manipulate SE_1113 expression and structure would enable detailed mechanistic studies that are challenging with traditional genetic approaches.

What interdisciplinary approaches could advance understanding of SE_1113 in skin microbiome dynamics?

Advancing our understanding of SE_1113's role in skin microbiome dynamics requires integrating multiple disciplines:

  • Multi-omics Integration:

    • Combine proteomics, transcriptomics, and metabolomics data to create comprehensive models of SE_1113 function

    • Correlate SE_1113 activity with microbiome composition using metagenomic approaches

    • Analyze how host factors influence SE_1113 expression through integrated host-microbe transcriptomics

  • Advanced Imaging Techniques:

    • Apply super-resolution microscopy to visualize SE_1113 localization during colonization

    • Use fluorescent reporters to track SE_1113 activity in real-time within microbial communities

    • Implement spatial transcriptomics to map expression patterns in situ on skin

  • Systems Biology Modeling:

    • Develop mathematical models predicting how SE_1113 activity affects microbial community dynamics

    • Create agent-based models simulating interactions between SE_1113-expressing and non-expressing strains

    • Integrate models with experimental data to generate testable hypotheses

  • Clinical Translation:

    • Correlate SE_1113 variants with clinical outcomes in skin conditions

    • Study how SE_1113 function differs between healthy individuals and those with skin disorders

    • Investigate how therapeutic interventions affect SE_1113 activity in the skin microbiome

Research has shown that S. epidermidis isolates from atopic dermatitis skin have higher protease activity than those from healthy skin , suggesting that proteases like SE_1113 may play important roles in skin disease. Interdisciplinary approaches could clarify how these differences arise and their implications for skin health and disease.

Human Skin Equivalent models have proven valuable for studying S. epidermidis proteases and could serve as an excellent platform for interdisciplinary investigations of SE_1113 function in a controlled but physiologically relevant context.

What are the best practices for designing controls in SE_1113 inhibition studies?

Robust inhibition studies for SE_1113 require carefully designed controls:

  • Enzyme Controls:

    • Wild-type SE_1113 (positive control)

    • Catalytically inactive SE_1113 mutant (negative control)

    • Concentration series to establish dose-dependent effects

    • Thermal stability assays to confirm that inhibitors bind without denaturing the enzyme

  • Inhibitor Controls:

    • Vehicle controls containing all solvent components without the inhibitor

    • Structurally related inactive compounds to control for non-specific effects

    • Time-dependent pre-incubation studies to distinguish between competitive and non-competitive inhibition

    • Counter-screening against related proteases to assess specificity

  • Assay Validation Controls:

    • Known serine protease inhibitors (e.g., PMSF) as reference standards

    • Substrate concentration series to determine kinetic parameters

    • pH and temperature controls to ensure optimal enzyme activity

    • Positive controls with established inhibition profiles

  • Cellular Controls:

    • Genetic deletion strains to validate target engagement in vivo

    • Toxicity controls to ensure inhibitor effects are target-specific

    • Time-course studies to distinguish between immediate and downstream effects

The experimental design should follow best practices for enzyme inhibition studies as outlined in standard methodological guidelines . Statistical analysis should include appropriate tests for determining IC50 values and inhibition constants, with clear reporting of confidence intervals.

How can researchers ensure reproducibility in SE_1113 functional studies?

Ensuring reproducibility in SE_1113 research requires systematic attention to experimental design, execution, and reporting:

  • Standardized Materials:

    • Use well-characterized S. epidermidis strains with documented provenance

    • Prepare recombinant SE_1113 using consistent expression and purification protocols

    • Validate protein quality by multiple methods (SDS-PAGE, mass spectrometry, activity assays)

    • Use defined media compositions with controlled batch-to-batch variation

  • Protocol Standardization:

    • Develop detailed standard operating procedures (SOPs) for all methods

    • Include all experimental parameters in methods sections (temperatures, incubation times, buffer compositions)

    • Pre-register experimental designs and analysis plans when possible

    • Use automated systems where appropriate to reduce operator variation

  • Comprehensive Reporting:

    • Follow the minimum information guidelines for enzyme activity reporting

    • Document all statistical analyses with justification for tests used

    • Report both positive and negative results to avoid publication bias

    • Share raw data through appropriate repositories

  • Validation Across Systems:

    • Confirm key findings in multiple experimental models

    • Use alternative methodological approaches to validate critical results

    • Test reproducibility across different laboratories when possible

    • Implement blinded analysis for subjective measurements

Researchers should follow the guidelines for experimental design outlined in methodological literature , with particular attention to randomization, blinding, and appropriate sample sizes. Reporting should adhere to field-specific guidelines such as STROBE for observational studies or ARRIVE for animal experiments.

What statistical considerations are essential when analyzing SE_1113 activity in complex biological samples?

Analyzing SE_1113 activity in complex biological samples requires rigorous statistical approaches:

  • Experimental Design Considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization strategies to minimize batch effects

    • Paired designs when comparing treatments within the same biological sample

    • Factorial designs to evaluate multiple variables and their interactions

  • Data Preprocessing:

    • Normalization strategies to account for differences in sample loading or protein content

    • Transformation methods to address non-normal distributions (common in enzyme kinetic data)

    • Outlier detection with clear criteria for exclusion

    • Batch correction methods when analyzing samples processed at different times

  • Statistical Testing:

    • Non-parametric tests when assumptions of normality cannot be met

    • Mixed-effects models to account for repeated measures and nested data structures

    • Multiple comparison corrections (e.g., Benjamini-Hochberg) for large-scale analyses

    • Bayesian approaches for integrating prior knowledge and dealing with small sample sizes

  • Advanced Analytical Methods:

    • Principal component analysis to identify patterns in multivariate datasets

    • Clustering methods to identify groups of samples with similar SE_1113 activity profiles

    • Machine learning approaches for predictive modeling of SE_1113 function

    • Time series analysis for dynamic studies of SE_1113 activity

Researchers should implement appropriate quality control measures, including technical replicates to assess measurement variability and biological replicates to capture natural variation . Results should be presented with appropriate measures of uncertainty (confidence intervals or standard errors) rather than just p-values.

When designing experiments involving complex biological samples like skin models or clinical specimens, researchers should consult with biostatisticians during the planning phase to ensure appropriate study design and analysis strategies.

What are the most significant knowledge gaps regarding SE_1113 function?

Despite growing understanding of bacterial carboxyl-terminal processing proteases, several critical knowledge gaps remain for SE_1113:

  • Physiological Substrates: The natural substrates of SE_1113 in S. epidermidis remain largely unidentified, limiting our understanding of its functional role.

  • Regulatory Mechanisms: The conditions that regulate SE_1113 expression and activation in different environments are poorly characterized.

  • Structural Information: Detailed structural data for SE_1113 is lacking, hindering structure-based drug design efforts.

  • Host Interactions: How SE_1113 interacts with host factors during colonization and infection requires further investigation.

  • Strain Variation: The degree of conservation and functional variation of SE_1113 across different S. epidermidis strains remains unexplored.

Future research should prioritize addressing these gaps through integrated approaches combining genetics, biochemistry, structural biology, and infection models. The potential role of SE_1113 in virulence, suggested by studies of homologous proteases in other bacteria , makes this an important area for investigation.

How might emerging technologies transform our understanding of SE_1113 biology?

Emerging technologies promise to revolutionize our understanding of SE_1113 biology:

  • Single-Cell Techniques:

    • Single-cell RNA-seq could reveal heterogeneity in SE_1113 expression within bacterial populations

    • Single-cell proteomics might identify cell-to-cell variation in SE_1113 substrates

    • Microfluidic platforms could enable real-time monitoring of SE_1113 activity at the single-cell level

  • Advanced Structural Methods:

    • Cryo-electron microscopy could determine SE_1113 structure without crystallization

    • Hydrogen-deuterium exchange mass spectrometry might map dynamic interactions

    • AlphaFold2 and other AI-based structure prediction tools could provide structural insights even without experimental structures

  • In Situ Technologies:

    • Spatial transcriptomics could map SE_1113 expression in biofilms or infected tissues

    • MALDI imaging mass spectrometry might visualize SE_1113 substrates in their native context

    • Advanced fluorescent reporters could track SE_1113 activity in real-time during infection

  • Systems Biology Approaches:

    • Multi-omics integration could place SE_1113 in its broader network context

    • Machine learning approaches might predict new functions and interactions

    • Digital twin modeling could simulate the effects of SE_1113 modulation on bacterial physiology

These technologies will enable researchers to study SE_1113 with unprecedented resolution and in more physiologically relevant contexts, potentially transforming our understanding of its role in S. epidermidis biology and pathogenesis.

What collaborative research frameworks would accelerate SE_1113 research?

Accelerating SE_1113 research requires collaborative frameworks that integrate diverse expertise:

  • Interdisciplinary Research Consortia:

    • Bring together microbiologists, structural biologists, computational scientists, and clinicians

    • Establish shared resources including strain collections, protocols, and analytical pipelines

    • Implement common experimental standards to ensure comparability across studies

  • Open Science Initiatives:

    • Create repositories for sharing raw data, protocols, and reagents

    • Establish pre-registration platforms for SE_1113 research to reduce publication bias

    • Develop open-source analysis tools specific for protease research

  • Industry-Academic Partnerships:

    • Collaborate with pharmaceutical companies to develop and test SE_1113 inhibitors

    • Partner with biotechnology firms to develop high-throughput screening platforms

    • Engage with diagnostic companies to explore SE_1113 as a biomarker

  • Clinical Research Networks:

    • Establish biobanks of S. epidermidis isolates from different clinical contexts

    • Implement standardized clinical protocols for studying S. epidermidis infections

    • Develop shared patient cohorts for longitudinal studies of S. epidermidis colonization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.