Recombinant Staphylococcus epidermidis Probable CtpA-like serine protease (SERP0996)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SERP0996; Probable CtpA-like serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-491
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
SERP0996
Target Protein Sequence
MNDHQKNHATSQDDNTKSTPSKNSKHIKIKLWHFILVILGIILLTSIITVVSTILISHQK SGLNKEQRANLKKIEYVYQTLNKDYYKKQSSDKLTQSAIDGMVKELKDPYSEYMTAEETK QFNEGVSGDFVGIGAEMQKKNEQISVTSPMKDSPAEKAGIQPKDIVTQVNHHSVVGKPLD QVVKMVRGKKGTYVTLTIKRGSQEKDIKIKRDTIHVKSVEYEKKGNVGVLTINKFQSNTS GELKSAIIKAHKQGIRHIILDLRNNPGGLLDEAVKMANIFIDKGNTVVQLEKGKDKEELK TSNQALKQAKDMKVSILVNEGSASASEVFTGAMKDYHKAKVYGSKTFGKGIVQTIREFSD GSLIKYTEMKWLTPDGHYIHGKGIRPDVSISTPKYQSLNVIPDNKTYHQGEKDKNVKTMK IGLKALGYPIDNETNIFDEQLESAIKTFQQDNNLKVNGNFDKKTNDKFTEKLVEKANKKD TVLNDLLNKLK
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase S41A family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of Staphylococcus epidermidis CtpA-like serine protease?

Staphylococcus epidermidis CtpA-like serine protease (SERP0996) is a hexameric protein composed of a trimer of dimers. Each protomer consists of distinct domains, including an N-terminal dimerization region (NDR), a PDZ domain, a cap domain, a protease core domain, and a C-terminal dimerization region (CDR). The protein's hexameric assembly has been confirmed through gel filtration profile analysis, which showed an estimated mass consistent with a hexamer .

Structural studies typically utilize a truncated version of the protein with the N-terminal 37 amino acids removed (ΔN37 construct), as the first 23 residues constitute a type I signal sequence, followed by a 14-residue region enriched in alanine, glycine, and proline. This low-complexity region is predicted to be disordered, making it challenging for crystallization studies .

The PDZ domain of the protein is partially disordered in crystal structures, but homology modeling based on related proteins like CtpB has allowed researchers to generate accurate structural models guided by selenomethionine residues .

What is the functional role of serine proteases from Staphylococcus epidermidis in human skin?

Staphylococcus epidermidis serine proteases play significant roles in the skin microbiome and can influence host immune responses. The extracellular serine protease (Esp) from S. epidermidis has been identified as a dominant candidate allergen that can elicit type 2-biased immune responses, particularly in patients with atopic dermatitis (AD) .

The immune response to these proteases differs between healthy individuals and those with atopic dermatitis. In healthy adults, the T cell response is characterized by IL-17, IL-22, IFN-γ, and IL-10 production, whereas in AD patients, T cells lack IL-17 production and release only low amounts of IL-22, IFN-γ, and IL-10, with higher Th2 cytokine release instead .

How does the oligomeric assembly of CtpA-like serine protease impact its function?

The oligomeric assembly of CtpA-like serine protease significantly impacts its functional properties. Research has demonstrated that CtpA forms a hexamer comprising a trimer of dimers, which is essential for its optimal activity. This assembly is mediated primarily through the C-terminal dimerization region (CDR) .

Experimental evidence supports the critical role of the C-terminal region in hexamer formation. When researchers constructed a mutant with a partially disrupted H6 helix by removing the last six residues (Ser-431 to Asn-436; CtpA(ΔC6)), the protein eluted from a gel filtration column as a dimer rather than a hexamer. Cryo-EM 2D class averages and 3D reconstruction confirmed that this mutant protein assembled as a dimer, with the two subunits expanded outward by 4 Å relative to the CtpA dimer in the hexamer .

This structural reorganization upon C-terminal truncation suggests that the hexameric assembly constrains the conformation of individual protomers, which may be necessary for proper substrate recognition and catalytic efficiency. The alteration in quaternary structure likely affects the spatial arrangement of active sites and substrate-binding regions, potentially modifying enzyme kinetics and substrate specificity .

What are the current contradictions in research findings regarding S. epidermidis proteases and their role in atopic dermatitis?

Research on S. epidermidis proteases presents several apparent contradictions regarding their role in atopic dermatitis (AD). Studies show that while Esp (extracellular serine protease) from S. epidermidis can elicit type 2-biased immune responses characteristic of allergic reactions in AD patients, it remains unclear whether Esp is a key pathogenic factor in AD .

One contradiction centers on the role of different S. epidermidis proteases in skin pathology. While Esp demonstrates immunological activity, mouse models indicate that another protease, EcpA, is more crucial for causing severe skin lesions, with Esp being insufficient for this purpose . This suggests that different proteases from the same organism may have distinct and potentially opposing roles in skin homeostasis and disease.

Another apparent contradiction involves the immune response to S. epidermidis antigens. Not all S. epidermidis antigens elicit the same type of immune reaction even in AD patients. For instance, while there is an increased IgE reaction to Esp in AD patients, no such increase is observed for GehD (triacylglycerol lipase) from the same bacterium . This selectivity in immune responses challenges simplified models of host-microbe interactions in AD.

These contradictions may be explained by contextual differences in experimental models, patient populations, or comorbid conditions. Resolving such contradictions requires careful analysis of study methodologies, including differences in experimental design, sample preparation techniques, and data interpretation approaches .

How does the immune response to S. epidermidis serine proteases differ between healthy individuals and atopic dermatitis patients?

The immune response to S. epidermidis serine proteases exhibits significant differences between healthy individuals and atopic dermatitis (AD) patients, particularly regarding antibody production and T cell responses .

Antibody Responses:

Antibody TypeHealthy ControlsAD PatientsStatistical Significance
IgG1 (anti-Esp)DetectableSignificantly higherP≤0.05
IgG4 (anti-Esp)VariableSignificantly higherP≤0.01
IgE (anti-Esp)Low levelsSignificantly higherP≤0.05
IgE/IgG1 ratioLowerHigherP≤0.0001

AD patients demonstrate significantly elevated serum concentrations of S. epidermidis-specific IgG1 and IgG4 compared to healthy controls, indicating extensive exposure of the immune system to S. epidermidis and memory formation in AD .

T Cell Responses:

CytokineHealthy ControlsAD Patients
IL-17A/FPresentAlmost absent
IL-22HigherLower
IFN-γHigherLower
IL-10HigherLower
IL-5LowerHigher
IL-13LowerHigher

T cells from healthy individuals respond to Esp with a predominant type 1/3 cytokine profile (IL-17, IL-22, IFN-γ, and IL-10). In contrast, T cells from AD patients show a pronounced Th2-biased response with higher production of IL-5 and IL-13, coupled with substantially reduced type 1/3 cytokines .

This immune profile shift indicates that in AD, the balance between type 1/3 and type 2 inflammation is altered, with the immune system responding to Esp with IgE production and a Th2 cell bias – hallmarks of allergic reactions .

Expression System and Construct Design:

For optimal expression of recombinant SERP0996, researchers typically employ a truncated construct removing the N-terminal 37 amino acids (ΔN37). This modification eliminates the type I signal sequence (first 23 residues) and a disordered low-complexity region (next 14 residues), significantly improving protein solubility and crystallization properties .

Purification Protocol:

  • Initial Capture: Affinity chromatography using a tag-specific resin (His-tag or alternative tag determined during production process)

  • Buffer Composition: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Storage Conditions: Store at -20°C for short-term use or -80°C for extended storage

  • Working Stock Preparation: Prepare working aliquots stored at 4°C for up to one week to avoid repeated freeze-thaw cycles

Key Considerations:

  • Expression region: 1-491 amino acids (full-length protein)

  • Add protease inhibitors during initial lysis to prevent autoproteolysis

  • The protein forms hexamers in solution, which must be considered when designing size-exclusion chromatography steps

  • Avoid repeated freezing and thawing as this can compromise protein activity and structural integrity

What analytical methods are most effective for studying the interaction between S. epidermidis proteases and human immune components?

Several analytical methods have proven effective for studying interactions between S. epidermidis proteases and human immune components:

Immunological Binding Assays:

  • ELISA: Effective for measuring specific antibody binding (IgE, IgG1, IgG4) to recombinant proteases. Sample dilutions of 1:50 for human serum are typically used with HRP-conjugated secondary antibodies at 10 μg/mL .

  • Immunoblotting: Both 1D and 2D immunoblotting can visualize binding of serum antibodies to bacterial extracellular proteins. For 2D immunoblotting followed by mass spectrometry, pooled sera from patients can identify dominant IgG4-binding proteins .

Proteomic Methods:

  • 2D-gel electrophoresis coupled with LC-MS/MS: Effective for identifying IgG4-binding spots and determining protein identity .

  • Mass Spectrometry: Useful for determining protease cleavage sites on targets such as IL-33 .

T Cell Response Assays:

  • T Cell Stimulation: Isolating T cells from patients and controls, stimulating with recombinant protease, and measuring secreted cytokines provides valuable information about cellular immune responses .

  • Cytokine Profiling: Measuring type 1/3 (IL-17, IL-22, IFN-γ, IL-10) and type 2 (IL-5, IL-13) cytokines to characterize the immune polarization .

Structural Biology Approaches:

  • X-ray Crystallography: For high-resolution structural analysis (achieved resolution of 3.3-3.5 Å for CtpA) .

  • Selenomethionine Substitution: For phase determination in crystallography using SAD-based phasing .

  • Cryo-EM: For analyzing oligomeric assemblies and confirming quaternary structure .

How can researchers differentiate between true contradictions and apparent contradictions in studies of S. epidermidis proteases?

Differentiating between true contradictions and apparent contradictions in studies of S. epidermidis proteases requires systematic analysis of contextual factors that may explain seemingly disparate findings. Researchers should:

Analyze Experimental Context Variables:

  • Species differences: Verify whether contradictory results stem from studies using different species (human vs. mouse models) .

  • Strain variations: Confirm if different S. epidermidis strains were used, as genetic variation between strains can lead to functional differences in proteases .

  • Administration differences: Examine if contradictory findings involve different modes of administration or exposure routes .

Apply Semantic Analysis Techniques:

  • Use semantic predication analysis to extract and compare claims across the literature, focusing on subject-predicate-object relationships that appear contradictory .

  • Employ natural language processing tools (like SemRep) that can process biomedical literature at scale and extract normalized semantic relationships .

Consider Methodological Differences:

  • Compare protein preparation methods, as differences in recombinant expression systems, purification protocols, or storage conditions can affect protein activity .

  • Assess whether different truncations or mutations of the protease were used (e.g., full-length vs. ΔN37 construct or CtpA(ΔC6) mutant) .

  • Examine differences in oligomeric state, as hexameric vs. dimeric forms may have different functional properties .

Evaluate Clinical Context:

  • Consider patient population differences, including severity of atopic dermatitis, age, sex, and comorbidities .

  • Analyze whether contradictions might reflect legitimate biological variation rather than experimental error .

Implement Systematic Literature Review Methods:

  • Develop explicit criteria for categorizing contextual differences that might explain apparent contradictions .

  • Use automated text analysis techniques to flag potentially contradictory claims and identify study characteristics that may explain such contradictions .

What are the main technical challenges in studying the structure-function relationship of CtpA-like proteases?

Several technical challenges complicate structure-function studies of CtpA-like proteases:

  • Protein Stability and Crystallization: The presence of low-complexity regions and disordered segments, particularly in the N-terminal region and the PDZ domain, makes crystallization difficult. Researchers typically use truncated constructs (e.g., ΔN37) to improve crystallization properties, but this modification may alter native functional properties .

  • Oligomeric State Determination: The protein exists as a hexamer (trimer of dimers) in solution, and maintaining this quaternary structure during purification and analysis requires careful buffer optimization. The oligomeric assembly can be disrupted by modifications like the CtpA(ΔC6) mutation, complicating structure-function correlations .

  • Resolution Limitations: Current structural data for CtpA has been limited to moderate resolution (3.3-3.5 Å), making it challenging to visualize detailed active site interactions and catalytic mechanisms. Some regions remain partially disordered in crystal structures, requiring complementary techniques for complete structural characterization .

  • Physiological Substrate Identification: Identifying natural substrates in the host environment remains challenging. While IL-33 has been identified as one substrate for Esp, comprehensive profiling of physiological substrates requires specialized proteomic approaches .

  • Integration of Multiple Techniques: Combining X-ray crystallography with cryo-EM, molecular dynamics simulations, and functional assays is necessary but technically demanding. The partially disordered PDZ domain required homology modeling guided by selenomethionine anomalous density peaks for accurate placement .

How can researchers address the apparent contradiction between sensitization to S. epidermidis proteases and their prevalence in healthy individuals?

Addressing the contradiction between widespread sensitization to S. epidermidis proteases and their prevalence in healthy individuals requires multifaceted research approaches:

What novel methodological approaches are needed to fully characterize the role of S. epidermidis proteases in skin homeostasis and disease?

To fully characterize the role of S. epidermidis proteases in skin homeostasis and disease, several novel methodological approaches are needed:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.