Recombinant Staphylococcus epidermidis Probable elastin-binding protein ebpS (ebpS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus epidermidis Probable Elastin-Binding Protein ebpS

The Recombinant Staphylococcus epidermidis Probable elastin-binding protein ebpS (ebpS) is a protein expressed in Escherichia coli, derived from the bacterium Staphylococcus epidermidis. This protein is of interest due to its potential role in mediating interactions between bacterial cells and components of the extracellular matrix, such as elastin. Elastin is a crucial protein in the human body, providing elasticity to tissues like skin, lungs, and blood vessels.

Biofilm Formation

EbpS in Staphylococcus epidermidis has been implicated in enhancing biofilm formation, particularly through interactions with PNAG, a key biofilm component . This highlights the protein's role in bacterial persistence and resistance within host environments.

Expression and Purification

The recombinant ebpS protein is expressed in E. coli and purified using affinity chromatography due to its His tag. The protein is available in a lyophilized form with a purity of over 90% as determined by SDS-PAGE .

Table 2: Amino Acid Sequence of ebpS (Partial)

The amino acid sequence of ebpS from Staphylococcus epidermidis includes motifs such as MSNNNFKDDFEKNRQSINPDEHQTELKEDDKTNENKKEADSQNSLSNNSNQQFPPRNAQR RKRRRETATNQSKQQDDKHQKNSDAKTTEGSLDDRYDEAQLQQQHDKSQQQNKTEKQSQD NRMKDGKDAAIVNGTSESPEHKSKSTQNRPGPKAQQQKRKSESTQSKPSTNKDKKAATGA GIAGAAGVAGAAETSKRHHNKKDKQDSKHSNHENDEKSVKNDDQKQSKKGKKAAVGAGAA AGVGAAGVAHHNNQNKHHNEEKNSNQNNQYNDQSEGKKKGGFMKILLPLIAAILILGAIA IFGGMALNNHNDSKSDDQKIANQSKKDSDKKDGAQSEDNKDKKSDSNKDKKSDSDKNADD DSDNSSSNPNATSTNNNDNVANNNSNYTNQNQQDNANQNSNNQQATQGQQSHTVYGQENL YRIAIQYYGEGTQANVDKIKRANGLSSNNIHNGQTLVIPQ .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ebpS; SERP1048; Probable elastin-binding protein EbpS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
ebpS
Target Protein Sequence
MSNNNFKDDFEKNRQSINPDEHQTELKEDDKTNENKKEADSQNSLSNNSNQQFPPRNAQR RKRRRETATNQSKQQDDKHQKNSDAKTTEGSLDDRYDEAQLQQQHDKSQQQNKTEKQSQD NRMKDGKDAAIVNGTSESPEHKSKSTQNRPGPKAQQQKRKSESTQSKPSTNKDKKAATGA GIAGAAGVAGAAETSKRHHNKKDKQDSKHSNHENDEKSVKNDDQKQSKKGKKAAVGAGAA AGVGAAGVAHHNNQNKHHNEEKNSNQNNQYNDQSEGKKKGGFMKILLPLIAAILILGAIA IFGGMALNNHNDSKSDDQKIANQSKKDSDKKDGAQSEDNKDKKSDSNKDKKSDSDKNADD DSDNSSSNPNATSTNNNDNVANNNSNYTNQNQQDNANQNSNNQQATQGQQSHTVYGQENL YRIAIQYYGEGTQANVDKIKRANGLSSNNIHNGQTLVIPQ
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of elastin-binding protein (EbpS) in Staphylococcus epidermidis biofilm formation?

EbpS functions as a major PNAG-interacting protein in S. epidermidis biofilms. Recent proximity labeling approaches combined with quantitative mass spectrometry-based proteomics have revealed that the lysin motif (LysM) domain of EbpS specifically binds to poly-(1→6)-β-N-acetylglucosamine (PNAG), which serves as a major structural component of S. epidermidis biofilms. This interaction appears crucial for biofilm stability and formation, contributing to the pathogen's ability to cause nosocomial infections .

How does EbpS differ structurally from other bacterial adhesion proteins?

EbpS contains a distinctive C-terminal LysM domain (amino acids 399-460) that enables specific binding to PNAG in bacterial biofilms. Unlike many other bacterial adhesion proteins that primarily interact with host components, EbpS has demonstrated significant interactions with bacterial exopolysaccharides, suggesting its dual role in both host adhesion and biofilm architecture. The protein structure features transmembrane regions that anchor it to the bacterial cell surface, with exposed domains facilitating these crucial interactions .

What evidence-based approaches are recommended for studying bacterial binding proteins?

The evidence-based practice (EBP) model recommends following five key steps: (1) asking a focused research question, (2) acquiring the best available evidence through systematic literature review, (3) appraising the quality of evidence, (4) applying findings to experimental design, and (5) evaluating outcomes. For bacterial binding proteins specifically, this approach involves combining structural analysis, functional assays, and molecular interaction studies, while considering the clinical context of biofilm-associated infections .

How can I design recombinant EbpS constructs for functional studies?

To design recombinant EbpS constructs for functional studies, researchers should:

  • Identify the functional domains of interest, particularly the LysM domain (residues 399-460)

  • Design appropriate fusion constructs with reporter proteins (e.g., eGFP)

  • Include cleavable linker regions (such as TEV protease recognition sites) for protein purification flexibility

  • Optimize codon usage for the expression system (typically E. coli)

  • Include appropriate purification tags that won't interfere with functional domains

The validated approach involves fusing the C-terminal LysM domain of EbpS to eGFP through a short tobacco etch virus protease (TEV) cleavable linker, allowing for effective visualization of binding interactions while maintaining functional activity .

What experimental controls are necessary when studying EbpS-PNAG interactions?

Rigorous experimental design for studying EbpS-PNAG interactions requires multiple controls:

  • Negative organism control: Use PNAG-negative S. epidermidis strains (e.g., NCTC11047) to confirm binding specificity

  • Enzymatic degradation control: Pre-treat biofilms with PNAG-specific hydrolases (e.g., DspB) to disrupt the interaction

  • Domain specificity control: Test truncated versions of EbpS lacking the LysM domain

  • Binding competition assay: Use purified PNAG to competitively inhibit EbpS binding

  • Non-specific binding control: Include irrelevant fusion proteins (e.g., eGFP alone)

How can single-subject experimental designs (SSEDs) be applied to EbpS research?

SSEDs can be valuable for initial characterization of EbpS variants before scaling to larger experiments. When applied to EbpS research, consider these methodological approaches:

  • Define precise dependent variables (e.g., binding affinity, biofilm disruption)

  • Ensure consistent measurement across multiple assessment occasions

  • Establish baseline performance before introducing interventions

  • Document the fidelity of independent variable implementation

  • Demonstrate experimental control via three demonstrations of effect

The quality standards for SSEDs in EbpS research require sufficient detail in participant selection, physical setting description, operationalization of variables, and demonstration of experimental control. This approach allows for rigorous preliminary testing of hypotheses about EbpS function before proceeding to more resource-intensive experimental designs .

What techniques can identify novel binding partners of EbpS beyond PNAG?

To identify novel binding partners of EbpS beyond PNAG, researchers should implement complementary methodologies:

  • Proximity Labeling Approaches: Modify the live cell proximity labeling technique used to identify PNAG interaction, employing enzyme-catalyzed proximity labeling with promiscuous enzymes (BioID, APEX) fused to EbpS to biotinylate nearby proteins.

  • Affinity Purification-Mass Spectrometry: Use recombinant EbpS variants as bait proteins in pull-down assays followed by quantitative proteomics.

  • Surface Plasmon Resonance: Assess binding kinetics with candidate interactors immobilized on sensor chips.

  • Crosslinking Mass Spectrometry: Apply chemical crosslinkers to stabilize transient interactions for identification.

  • Yeast Two-Hybrid Screening: Screen for protein-protein interactions using EbpS domains as bait.

These approaches should be applied in multiple strains and growth conditions to comprehensively map the EbpS interactome .

How do mutations in the LysM domain affect EbpS function in biofilm formation?

The impact of LysM domain mutations on EbpS function requires systematic structure-function analysis:

  • Create a library of site-directed mutants targeting conserved residues within the LysM domain (399-460)

  • Express mutant variants as recombinant fusion proteins

  • Assess binding affinity to purified PNAG and intact biofilms

  • Measure effects on biofilm formation when mutant proteins are introduced to growing cultures

  • Perform structural analysis (e.g., circular dichroism, nuclear magnetic resonance) to correlate functional changes with structural alterations

Mutations in critical binding residues would be expected to show reduced binding to PNAG in biofilms, while mutations affecting protein folding might completely abolish function. This approach helps elucidate the molecular basis of EbpS-PNAG interactions in biofilm architecture .

What is the potential for EbpS-targeting strategies in anti-biofilm therapeutics?

EbpS-targeting therapeutic strategies represent a promising approach for disrupting S. epidermidis biofilms in clinical settings. Research directions should include:

  • Development of competitive inhibitors based on the LysM domain structure

  • Design of peptide mimetics that disrupt EbpS-PNAG interactions

  • Antibody-based approaches targeting exposed EbpS epitopes

  • Combination strategies with conventional antibiotics to enhance penetration

  • Assessment of resistance development through longitudinal studies

The methodological approach would involve initial in vitro screening, followed by ex vivo testing on clinical biofilm samples, and ultimately animal model validation. Essential considerations include delivery mechanisms, biofilm penetration, and potential off-target effects on commensal bacteria .

How can I quantitatively measure EbpS binding to PNAG in live biofilms?

Quantitative measurement of EbpS binding to PNAG in live biofilms requires:

  • Fluorescence-Based Assays: Use the EbpS LysM-eGFP fusion protein to visualize binding through confocal microscopy, with quantification of fluorescence intensity.

  • Competition Assays: Pre-incubate biofilms with varying concentrations of unlabeled EbpS before adding labeled protein to generate binding curves.

  • Flow Cytometry: Analyze single-cell binding in dispersed biofilm samples using fluorescently labeled EbpS.

  • Surface Plasmon Resonance: For kinetic parameters, immobilize purified PNAG and measure real-time binding.

  • Fluorescence Recovery After Photobleaching (FRAP): Assess dynamic binding in live biofilms.

Analysis should employ appropriate statistical methods, typically reporting binding as relative fluorescence units normalized to biofilm biomass or cell count .

What evidence-based framework should be used to evaluate EbpS binding specificity?

An evidence-based evaluation framework for EbpS binding specificity should follow these methodological steps:

  • Formulate Specific Questions: Define precise aspects of binding specificity to be evaluated.

  • Systematic Evidence Collection: Design experiments that test binding to:

    • Various polysaccharides (PNAG, other bacterial exopolysaccharides)

    • Different S. epidermidis strains (PNAG-positive and negative)

    • Related staphylococcal species

  • Critical Appraisal: Apply rigorous statistical analysis to binding data, considering potential confounding factors.

  • Integrate Findings: Synthesize results from multiple methodologies into a comprehensive binding profile.

  • Evaluate Outcomes: Assess implications for biofilm formation and potential therapeutic targeting.

This approach aligns with the five-step EBP model, ensuring methodological rigor and comprehensive evaluation of binding specificity .

How should experimental data on EbpS-PNAG interactions be analyzed and interpreted?

Data analysis for EbpS-PNAG interaction studies should include:

Analysis ApproachApplicationOutput MetricsInterpretation Guidelines
Binding KineticsSPR, Microscale ThermophoresisKd, kon, koff valuesCompare across EbpS variants and conditions
Fluorescence QuantificationConfocal microscopyRelative fluorescence units, binding curvesNormalize to biomass or cell count
Statistical AnalysisComparative binding studiesp-values, confidence intervalsApply appropriate multiple testing corrections
Domain Function MappingMutational studies% activity relative to wild-typeIdentify critical binding residues
Structural CorrelationCD, NMR with binding dataStructure-function relationshipsLink structural features to binding properties

Data interpretation should consider:

  • Biological significance of binding affinities in the context of biofilm formation

  • Potential confounding factors (e.g., protein aggregation, non-specific binding)

  • Consistency across multiple experimental approaches

  • Relevance to in vivo biofilm formation

  • Implications for therapeutic development

How can mixed methods research enhance understanding of EbpS function?

A mixed methods approach to investigating EbpS function combines quantitative binding and structural data with qualitative observational data to provide comprehensive insights:

  • Quantitative Components:

    • Binding affinity measurements

    • Structural analysis data

    • Biofilm formation quantification

  • Qualitative Components:

    • Microscopic observation of binding patterns

    • Phenotypic characteristics of biofilms

    • Morphological changes following intervention

Integration of these approaches should follow a convergent design, where both data types are collected concurrently, analyzed separately, and then merged into comprehensive findings. This approach allows researchers to identify complementary aspects of EbpS function that might be missed by single-method investigations .

What are the best practices for validating recombinant EbpS protein functionality?

Validation of recombinant EbpS protein functionality requires a multi-faceted approach:

  • Structural Validation:

    • Circular dichroism to confirm secondary structure

    • Size exclusion chromatography to assess oligomeric state

    • Mass spectrometry to verify protein integrity

  • Functional Validation:

    • Binding assays with purified PNAG

    • Live biofilm binding experiments

    • Competition assays with native protein

  • Comparative Analysis:

    • Activity compared to native protein where possible

    • Cross-validation using multiple expression systems

    • Testing under various physiological conditions

  • Controls:

    • Non-binding mutants as negative controls

    • Demonstration of specificity through binding to PNAG-negative strains

    • Pre-treatment with PNAG-degrading enzymes

Documentation should include detailed methods for protein production, purification yields, stability assessments, and functional metrics to ensure reproducibility .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.