Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 2 (qoxA)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

  • Gene Name: qoxA (SE_0759 in some strains)

  • Synonyms: Quinol oxidase polypeptide II, Probable quinol oxidase subunit 2 .

  • UniProt IDs: Q5HQA9 (full-length) , Q8CPP6 (partial) , Q8CMQ2 (partial) .

  • Sequence Length:

    • Full-length: 355 amino acids (20-374 aa) .

    • Partial: 189 amino acids (1-189 aa) .

The protein contains a His-tag (N-terminal in recombinant versions) and shares structural homology with quinol oxidase subunits in other Gram-positive bacteria.

Biochemical Properties

PropertyValue/Description (Full-Length)Source
Molecular Weight~39 kDa
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS, 6% trehalose, pH 8.0
Reconstitution0.1–1.0 mg/mL in sterile water
Stability-20°C/-80°C (lyophilized)

Expression Systems and Tags

Recombinant qoxA is produced in:

  • E. coli: Full-length protein with N-terminal His-tag .

  • Yeast: Partial-length protein (e.g., 1-189 aa) .

Quinol Oxidase Activity

qoxA is a subunit of a cytochrome bd-type quinol oxidase, which catalyzes electron transfer from quinols to oxygen in the ETC . This enzyme is critical for:

  • Aerobic respiration: Under oxic conditions, it supports bacterial growth and biofilm formation .

  • Oxygen adaptation: Regulated by the SrrAB two-component system, which modulates qoxBACD operon expression (including qoxA) in response to oxygen levels .

Regulation and Biofilm Formation

  • SrrAB dependency: SrrAB upregulates qoxBACD under oxic conditions, linking qoxA expression to electron transport efficiency and biofilm maturation .

  • Metabolic adaptation: qoxA activity is coupled with fermentation pathways (e.g., pflBA) under microaerobic conditions, enabling survival in diverse niches .

Diagnostic and Analytical Tools

  • ELISA kits: Recombinant qoxA is used as an antigen to detect anti-S. epidermidis antibodies .

  • Western blotting: Validates protein expression in S. epidermidis mutants or clinical isolates .

Functional Studies

  • Biofilm regulation: qoxA knockout models investigate its role in oxygen-dependent biofilm formation .

  • Protein-protein interactions: Studies explore SrrAB binding to qoxA promoter regions .

Oxygen-Dependent Regulation

  • Oxic conditions: SrrAB activates qoxBACD (including qoxA) to enhance ETC activity and biofilm production .

  • Microaerobic conditions: SrrAB downregulates qoxA while upregulating fermentation genes (e.g., pflBA) .

Clinical Relevance

  • Pathogenicity: qoxA is expressed in both commensal and pathogenic S. epidermidis strains, though its role in virulence remains unclear .

  • Antibiotic resistance: Horizontal gene transfer of mecA (methicillin resistance) in S. epidermidis populations may intersect with qoxA-related metabolic pathways .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: Tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
qoxA; SERP0646; Probable quinol oxidase subunit 2; Quinol oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-374
Protein Length
Full Length of Mature Protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
qoxA
Target Protein Sequence
CSNIEVFNAKGPVASSQKFLIIYSIIFMLVIVAVVLSMFAIFIFKYSYKKNSESGKMHHN SLIETIWFVVPILIVIALAIPTVKTLYDYEKPPEKDKDPLVVYAVSAGYKWFFAYPDQHI ETVNTLTIPKDRPVVFKLQSMDTMTSFWIPQLGGQKYAMTGMTMNWTLTADQLGTFRGRN SNFNGEGFSRQTFKVHSVSQNDFDKWVKEAKGKKTLSQDTFDKQLLPSTSNKELTFSGTH MAFVDPAADPEYIFYAYKRYNFEQKDPNFTAEEDLYKDVKDKPIKPARKVHITNPNYERH GMKPMILGNNEKYDNEFKKEEDHNSKEMEKISKGAKDENASKLHKKEHDDHGGGH
Uniprot No.

Target Background

Function
This protein catalyzes quinol oxidation, concurrently reducing oxygen to water. Subunit II facilitates electron transfer from a quinol to the binuclear center of the catalytic subunit I.
Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.