Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 3 (qoxC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes section, and we will fulfill your requirements to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
qoxC; SERP0644; Probable quinol oxidase subunit 3; Quinol oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
qoxC
Target Protein Sequence
MSHDANTIDSRTHEGELNKLGFWIFLTAEFALFGTLFATLLTLQHGGGYGGKLTTDLFEL HLILIMTFALLISSYTCGIAIYYMRQEKQNLMMFWMIITVILGLVFVGFEIYEFAHYASE GVNPTIGSFWSSFFILLGTHGAHVSLGIVWVICLLIQIGTRGLDSYNAPKLFIVSLYWHF LDVVWVFIFTAVYMIGMVYSG
Uniprot No.

Target Background

Function
Catalyzes quinol oxidation with the concomitant reduction of oxygen to water.
Database Links
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is quinol oxidase subunit 3 (qoxC) and what is its function in Staphylococcus epidermidis?

Quinol oxidase subunit 3 (qoxC) is a component of the terminal respiratory oxidase complex in S. epidermidis. This complex plays a crucial role in oxygen utilization during aerobic respiration by catalyzing the oxidation of quinol and the reduction of oxygen to water. The process contributes to energy generation through the creation of a proton gradient across the bacterial membrane.

In S. epidermidis, qoxC functions as part of the adaptive response to varying oxygen conditions. Research by Uribe-Alvarez et al. indicates that S. epidermidis expresses different terminal oxidases depending on oxygen availability, with cytochromes bo and aa3 being expressed under aerobic conditions . The qoxC protein belongs to this respiratory complex system that allows the bacterium to adapt to different microenvironmental conditions during colonization and infection.

How does qoxC expression relate to S. epidermidis pathogenicity?

The expression of qoxC and related respiratory chain components appears to correlate inversely with biofilm formation, a key virulence factor for S. epidermidis. According to studies, S. epidermidis shows minimal biofilm formation under aerobic conditions when cytochromes bo and aa3 are highly expressed . Under microaerobic and anaerobic conditions, when the expression pattern shifts toward alternative respiratory pathways, biofilm formation increases significantly.

This relationship suggests that respiratory adaptation, including the expression of qoxC, plays an important role in the pathogenic potential of S. epidermidis. The correlation between redox enzyme activity and biofilm formation indicates that these respiratory components could serve as potential therapeutic targets for addressing S. epidermidis infections .

How do small colony variants (SCVs) of S. epidermidis differ in their qoxC expression?

Small colony variants (SCVs) of S. epidermidis represent an adaptation to chronic infection conditions and typically display altered respiratory function. Research on a hemin-dependent SCV strain revealed significant genomic modifications that could impact respiratory chain components like qoxC . These modifications include frameshift-generating mutations within poly(A) and poly(T) homopolymeric tracts affecting genes involved in metabolism and stress response.

A notable finding was a deletion in the poly(A) of the hemA gene, identified as a possible trigger factor for the SCV phenotype and hemin auxotrophy . Since hemA is involved in heme biosynthesis, and heme is a critical component of cytochromes, this would directly affect the function of respiratory chain components including qoxC. This genomic adaptation appears to be part of the bacterium's strategy for persistence in chronic infections.

What experimental design considerations are crucial for studying qoxC function?

When investigating qoxC function, researchers should implement robust experimental designs that account for various sources of variability. Based on principles from proteomics research, the following approaches are recommended:

  • Blocking strategy: Implement experimental blocking to account for variability during experimental runs. A block is defined as "a set of experimental materials considered as consistent" with the objective of making comparisons between conditions as independent as possible from artifacts or heterogeneities .

  • ANOVA modeling: Use appropriate statistical models that account for various effects:

    • For individual experiments: Yjcg = (C)c + (G)g + Ejcg

    • For experiments with blocking: Yjcag = (A)a + (C)c + (AC)ac + Ejcag

    Where (C)c represents the condition effect, (G)g the gel effect in proteomics studies (or equivalent technical effect in other methods), (A)a the apparatus effect, and (AC)ac the interaction effect .

  • Oxygen control: Since qoxC expression is oxygen-dependent, establish precisely controlled oxygen conditions for all experiments .

  • Replication strategy: Include both biological and technical replicates to distinguish between different sources of variation and ensure robust statistical analysis.

What are the optimal conditions for measuring qoxC activity in vitro?

When studying qoxC activity in vitro, researchers should consider the following optimal conditions and approaches:

ParameterAerobicMicroaerobicAnaerobic
O₂ concentration>20%1-5%<0.1%
Growth mediaStandard TSBTSB with limited aerationAnaerobic TSB with alternative electron acceptors
Expected cytochromesbo and aa3 dominantbo presentbo reduced, nitrate reductase dominant
Typical biofilm formationLowModerateHigh
Recommended controlsWild-type S. epidermidisCytochrome inhibitors (e.g., KCN)Nitrate reductase inhibitors (e.g., methylamine)

Respiratory chain activity can be measured through oxygen consumption assays using polarographic methods with specific substrates for the quinol oxidase complex. When working with recombinant qoxC, maintain the integrity of membrane proteins by using appropriate detergents during extraction and purification. Optimal buffer conditions typically include pH 7.0-7.5 and temperatures around 30-37°C to maintain physiological relevance for S. epidermidis .

What approaches are recommended for quantifying qoxC protein expression levels?

For measuring qoxC protein expression levels, researchers should consider multiple complementary approaches:

  • Proteomic analysis: 2D gel electrophoresis followed by mass spectrometry can identify and quantify qoxC protein levels. Proper experimental design should include biological replicates and appropriate statistical analysis as described by Chich et al. .

  • Activity-based assays: Measure quinol oxidase activity as a proxy for functional protein levels using spectrophotometric methods that track electron transfer from quinol to oxygen.

  • Western blotting: Use specific antibodies against qoxC, with appropriate loading controls and quantification methods for semi-quantitative analysis.

  • qRT-PCR: While measuring mRNA rather than protein, this technique provides insights into transcriptional regulation of qoxC under different conditions and complements protein-level analyses.

  • Reporter systems: Construction of reporter gene fusions (e.g., qoxC promoter-GFP) enables monitoring of expression in real-time under different conditions, particularly useful for studying dynamic responses to changing oxygen levels.

How does qoxC expression correlate with biofilm formation in S. epidermidis?

The relationship between qoxC expression and biofilm formation appears to be linked to oxygen availability and respiratory adaptation. According to Uribe-Alvarez et al., biofilm formation in S. epidermidis shows an inverse relationship with oxygen concentration - biofilm formation is minimal under aerobic conditions, increases slightly under microaerobic conditions, and is highest under anaerobic conditions .

This pattern correlates with the expression of respiratory chain components. Under aerobic conditions, when qoxC and other components of the aerobic respiratory chain (cytochromes bo and aa3) are highly expressed, biofilm formation is low. As oxygen becomes limited and the expression of these components decreases, biofilm formation increases .

Importantly, experimental manipulation of respiratory chain function affects biofilm formation: KCN inhibition of the aerobic respiratory chain increases biofilm formation, while methylamine inhibition of nitrate reductase (the dominant terminal electron acceptor under anaerobic conditions) inhibits biofilm formation . This suggests that targeting respiratory chain components like qoxC could provide novel approaches for controlling biofilm formation and associated infections.

What genomic factors influence qoxC regulation in different S. epidermidis strains?

Genomic analysis of S. epidermidis strains reveals several factors that may influence qoxC regulation:

Comparative genomic analysis across different strains, particularly between commensal and pathogenic isolates, could provide further insights into the evolutionary adaptations affecting qoxC regulation in different S. epidermidis lifestyles.

How might qoxC function as a potential therapeutic target for S. epidermidis infections?

The potential of qoxC as a therapeutic target stems from its critical role in respiratory adaptation and its relationship to biofilm formation. Several lines of evidence suggest targeting approaches:

  • Respiratory chain-biofilm connection: The correlation between respiratory chain activity and biofilm formation identified by Uribe-Alvarez et al. suggests that targeting respiratory components like qoxC could disrupt biofilm development . Since biofilms contribute significantly to antibiotic resistance, this represents a promising approach.

  • Metabolic vulnerability: Under aerobic conditions, S. epidermidis relies on cytochromes including qoxC for energy generation . Inhibiting this pathway could create a metabolic vulnerability, particularly in aerobic infection sites.

  • Strain-specific targeting: Genomic characterization of different S. epidermidis strains, including SCVs, reveals variations that could potentially be exploited for strain-specific targeting strategies . Targeting the respiratory adaptations specific to pathogenic strains could provide selective approaches.

  • Combinatorial approaches: Combining respiratory chain inhibitors with conventional antibiotics might enhance efficacy against biofilm-associated infections. The effect of KCN on biofilm formation suggests that modulating respiratory function could sensitize bacteria to other antimicrobial agents .

Research into the specific structural features of qoxC and its interactions within the respiratory complex could facilitate the development of targeted inhibitors with potential therapeutic applications against S. epidermidis infections.

How can researchers address inconsistent results in qoxC expression studies?

When facing contradictory results in qoxC expression studies, researchers should consider several factors that might contribute to the discrepancies:

  • Oxygen control verification: As demonstrated by Uribe-Alvarez et al., S. epidermidis expresses different respiratory components under varying oxygen concentrations . Implement precise oxygen monitoring and control systems during all experimental stages and verify oxygen levels in all experimental compartments.

  • Growth phase standardization: The expression of respiratory chain components may vary with growth phase. Standardize cell collection at specific growth phases (early exponential, mid-exponential, stationary) across experiments and document growth curves for all experimental conditions.

  • Strain documentation: Different S. epidermidis strains may have variations in qoxC sequence or regulation. When comparing results across studies, ensure strain information is clearly documented and consider creating a reference table of strain characteristics including sequence type information .

  • Statistical robustness: Following Chich et al., implement proper experimental blocking and statistical analysis to account for variability between experimental runs . The ANOVA models described can help identify sources of variation and determine which differences are statistically significant.

  • Membrane protein technical considerations: Extraction and analysis of membrane proteins like qoxC present specific challenges. Variations in detergent type or concentration during purification can affect protein activity. Standardize membrane protein preparation protocols and include appropriate controls for each technical step.

What statistical approaches are recommended for analyzing qoxC expression data?

Based on the statistical approaches described by Chich et al. for proteomics data, the following recommendations apply to analyzing qoxC expression data :

How can researchers distinguish between direct and indirect effects on qoxC function?

Distinguishing between direct and indirect effects on qoxC function requires a multifaceted experimental approach and careful data interpretation:

  • Promoter analysis: Characterize the qoxC promoter region to identify potential regulatory elements. Create reporter constructs with the native promoter and with specific regulatory elements mutated to assess their direct contribution to expression regulation.

  • Time-course studies: Monitor changes in qoxC expression following specific perturbations. Direct regulatory effects typically manifest more rapidly than indirect effects mediated through metabolic adaptations or secondary regulatory pathways.

  • Metabolic perturbation analysis: Systematically perturb metabolic pathways that might indirectly affect qoxC expression (e.g., through changes in redox state or energy levels) and measure the resulting expression changes. Compare these with direct regulatory perturbations.

  • Genetic interaction studies: Create a matrix of genetic knockouts/knockdowns affecting both suspected direct regulators and metabolic pathways, then measure qoxC expression or activity. Analyze the pattern of interactions to distinguish direct from indirect effects.

ObservationDirect Effect EvidenceIndirect Effect EvidenceInterpretation
Expression changes rapidly after stimulusPromoter binding assay positive-Likely direct regulation
Expression changes with delayPromoter binding assay negativeMetabolite levels change before expressionLikely indirect regulation
Expression correlates with oxygen levelOxygen-responsive regulator binds promoter-Direct oxygen regulation
Expression changes in SCV strainsNo mutation in qoxC or promoterhemA mutation affects heme availabilityIndirect effect via heme biosynthesis

By systematically applying these approaches, researchers can build a comprehensive understanding of the regulatory network controlling qoxC expression and distinguish between direct regulatory mechanisms and indirect effects mediated through metabolic or other cellular pathways.

What are the key unresolved questions regarding qoxC function in S. epidermidis?

Several important questions about qoxC function in S. epidermidis remain to be addressed:

  • Structural characterization: Detailed structural information about qoxC in S. epidermidis is lacking. Determining its structure would provide insights into its function and potential for targeted inhibition.

  • Regulatory network: The complete regulatory network controlling qoxC expression under different environmental conditions remains to be elucidated. Identifying key transcription factors and their binding sites would enhance our understanding of S. epidermidis respiratory adaptation.

  • Host-pathogen interactions: How host factors influence qoxC expression during infection is poorly understood. Investigating the impact of host immune molecules, iron availability, and other factors on qoxC regulation could reveal important aspects of S. epidermidis pathogenesis.

  • Role in polymicrobial infections: S. epidermidis often exists in polymicrobial communities, but how interspecies interactions affect qoxC expression and function is unknown. This could be particularly relevant for medical device-associated infections.

  • Evolutionary adaptation: Comparative analysis of qoxC across different staphylococcal species and strains could provide insights into its evolutionary history and role in adaptation to different ecological niches.

What methodological advances would enhance research on qoxC and related proteins?

Advancing research on qoxC would benefit from several methodological improvements:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.