Recombinant Staphylococcus epidermidis Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes to ensure fulfillment of your specific requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request and incurs an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB1; SERP1338; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
crcB1
Target Protein Sequence
MQYLYIFVGGALGALIRFCLSMLNEGSTIPLGTFVANLLGAFLMGSIGALSLSLFKTHPN IKKGLTTGLLGALTTFSTFQFELVTLFNQHHFILFTIYGVTSYILGILSCYLGVKIGGRF S
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does crcB1 function in the context of S. epidermidis ecology?

Based on homology to other bacterial CrcB proteins, crcB1 likely functions as a fluoride ion exporter that protects the bacterium from fluoride toxicity. In the broader context, S. epidermidis is both a common skin commensal and an opportunistic pathogen that can cause significant infections, particularly orthopedic-device-related infections (ODRI) .

While the specific role of crcB1 hasn't been directly linked to pathogenicity in the available literature, it may contribute to bacterial survival in clinical environments where antimicrobial agents are present. S. epidermidis virulence is multifactorial, with biofilm formation and antibiotic resistance being key factors associated with poor clinical outcomes .

What are the optimal conditions for expressing and purifying recombinant crcB1 protein?

Expression System:

  • Host: E. coli is the preferred expression system for recombinant crcB1

  • Vector: Plasmids with inducible promoters (T7, tac) and appropriate fusion tags

  • Tags: N-terminal His-tag has been successfully used for purification

  • Expression conditions: Lower temperatures (16-25°C) often yield better results for membrane proteins

Purification Protocol:

  • Cell lysis: Sonication or high-pressure homogenization in buffer with protease inhibitors

  • Membrane fraction isolation through differential centrifugation

  • Detergent solubilization (common choices: DDM, LDAO, Triton X-100)

  • Affinity chromatography using Ni-NTA resins for His-tagged protein

  • Size exclusion chromatography for further purification

  • Lyophilization with stabilizing agents like trehalose

Storage Recommendations:

  • Store lyophilized protein at -20°C/-80°C

  • Reconstitute in deionized sterile water (0.1-1.0 mg/mL)

  • Add 5-50% glycerol for long-term storage

  • Avoid repeated freeze-thaw cycles

What methods are effective for studying crcB1 functional activity?

Fluoride Transport Assays:

  • Reconstitution into liposomes or proteoliposomes

  • Fluoride-selective electrode measurements

  • Fluorescent probes sensitive to fluoride concentration

  • Radioisotope (18F) flux assays

Structural Analysis Approaches:

  • Circular dichroism for secondary structure assessment

  • Limited proteolysis to identify domain boundaries

  • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Cryo-EM or X-ray crystallography for high-resolution structure (challenging for membrane proteins)

Interaction Studies:

  • Surface Plasmon Resonance (SPR)

  • Microscale Thermophoresis

  • Isothermal Titration Calorimetry

  • Cross-linking coupled with mass spectrometry

How can researchers investigate the relationship between crcB1 and biofilm formation in S. epidermidis?

Biofilm formation is a significant virulence factor in S. epidermidis infections, particularly in ODRI, where strong biofilm formation has been associated with poor clinical outcomes . While direct connections between crcB1 and biofilm formation aren't established in the literature, researchers can investigate potential relationships using:

Genetic Approaches:

  • Generate crcB1 knockout or overexpression mutants

  • Assess changes in biofilm formation using crystal violet assays, confocal microscopy, and biomass quantification

  • Perform complementation studies to confirm phenotypes

Expression Analysis:

  • Monitor crcB1 expression during different stages of biofilm development using qRT-PCR

  • Use fluorescent reporter constructs to visualize expression patterns within biofilms

  • Perform RNA-seq to identify co-regulated genes during biofilm formation

Physiological Studies:

  • Test biofilm formation under varying fluoride concentrations

  • Investigate if fluoride stress affects adhesion properties of S. epidermidis

  • Examine dual-species biofilms (e.g., with S. aureus) to assess ecological interactions

What roles might crcB1 play in antibiotic resistance or tolerance in S. epidermidis?

S. epidermidis clinical isolates frequently display antibiotic resistance, with aminoglycoside resistance significantly associated with poor clinical outcomes in ODRI patients . While direct evidence linking crcB1 to antibiotic resistance is not provided in the search results, several research directions could explore potential connections:

Resistance Profiling:

  • Compare antibiotic susceptibility profiles between wild-type and crcB1 mutant strains

  • Assess whether fluoride exposure alters antibiotic efficacy

  • Investigate potential synergies between fluoride-containing compounds and antibiotics

Persistence and Tolerance:

  • Examine whether crcB1 contributes to persister cell formation

  • Test tolerance to environmental stresses in crcB1 mutants

  • Evaluate membrane integrity and permeability changes in response to crcB1 activity

Clinical Correlations:

  • Analyze crcB1 sequence variations across clinical isolates with different resistance profiles

  • Investigate expression levels in multidrug-resistant strains

  • Assess potential correlations between crcB1 variants and treatment outcomes

What are the primary challenges in studying membrane proteins like crcB1 and potential solutions?

Structural Determination Challenges:

  • Difficulty in obtaining sufficient quantities of properly folded protein

  • Challenges in crystallization for X-ray diffraction studies

  • Maintaining native conformation during purification

Methodological Solutions:

  • Use of specialized expression systems for membrane proteins

  • Nanodiscs or amphipol stabilization for structural studies

  • Advanced computational methods for structure prediction

  • Cryo-EM approaches for membrane protein complexes

Functional Analysis Challenges:

  • Developing reliable ion transport assays

  • Distinguishing specific from non-specific effects

  • Reconstituting native membrane environments

How might crcB1 research contribute to understanding S. epidermidis adaptation in clinical environments?

S. epidermidis is a significant opportunistic pathogen in orthopedic-device-related infections , and understanding bacterial adaptation mechanisms is crucial for developing effective treatments.

Genomic Variation Analysis:

  • Compare crcB1 sequences across clinical isolates from different infection sites

  • Identify potential correlations between sequence variants and clinical outcomes

  • Assess copy number variations or paralog distributions

Transcriptional Regulation:

  • Investigate factors controlling crcB1 expression

  • Determine if expression changes in response to clinical stressors

  • Examine integration with stress response networks

Therapeutic Development Potential:

  • Evaluate crcB1 as a potential drug target

  • Develop high-throughput screening for inhibitors

  • Investigate eco-sustainable approaches, such as plant-derived extracts that might modulate crcB1 activity, similar to the pomegranate peel extract approach used for other S. epidermidis targets

How does S. epidermidis crcB1 compare to homologous proteins in other bacterial species?

Understanding the evolutionary context of crcB1 can provide insights into its function and importance:

Sequence Conservation:

  • Multiple sequence alignments show conservation of key transmembrane domains

  • Specific residues involved in fluoride binding are typically highly conserved

  • Variations may reflect ecological adaptations or functional specializations

Phylogenetic Analysis:

  • CrcB proteins are widely distributed across bacterial phyla

  • Some species contain multiple paralogs with potentially specialized functions

  • Horizontal gene transfer events may have shaped distribution patterns

Functional Divergence:

  • Transport kinetics may vary between homologs

  • Regulatory mechanisms could differ between species

  • Integration with species-specific stress response pathways

What is known about crcB1 distribution and variation within the S. epidermidis population?

Genomic Studies:

S. epidermidis isolates show considerable genomic variation , which could extend to crcB1:

  • Core vs. accessory genome placement

  • Single nucleotide polymorphisms affecting function

  • Copy number variations or paralog distributions

Expression Patterns:

Expression variations might correlate with:

  • Clinical vs. commensal isolates

  • Biofilm-forming vs. non-biofilm-forming strains

  • Antibiotic resistant vs. susceptible isolates

Experimental Design Considerations:

For researchers studying population variation:

  • Include diverse isolate collections (clinical, commensal, geographical diversity)

  • Employ whole genome sequencing and comparative genomics

  • Correlate genotypic variation with phenotypic characteristics

Table 1: Experimental Approaches for crcB1 Functional Characterization

Experimental ApproachMethodologyResearch QuestionAdvantagesLimitations
Recombinant ExpressionHis-tagged protein in E. coliProtein structure and functionWell-established protocolsMay affect protein folding
Ion Transport AssaysReconstituted proteoliposomesTransport kineticsDirect functional measurementTechnical complexity
Genetic KnockoutsCRISPR-Cas9 or allelic exchangePhysiological roleIn vivo relevancePotential compensation by homologs
Structural StudiesCryo-EM, X-ray crystallographyProtein architectureHigh-resolution informationChallenging for membrane proteins
Transcriptional AnalysisRNA-seq, qPCRRegulation and expressionGenome-wide contextLimited functional insights
Biofilm AssessmentCrystal violet assays, CLSMRole in biofilm formationClinical relevanceMultifactorial phenotype

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.