Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhB2 (mnhB2)

Shipped with Ice Packs
In Stock

Description

Contextual Overview of mnhB2 in Staphylococci

  • mnhB2 in S. aureus:
    The mnhB2 protein in S. aureus (strain Newman) is a putative antiporter subunit involved in sodium/proton exchange. Recombinant versions of this protein are produced for research purposes, typically in E. coli or yeast systems .

    • Function: Antiporters regulate intracellular pH and ion homeostasis, critical for bacterial survival under stress conditions.

    • Structure: The protein spans 141 amino acids and is part of a multi-subunit membrane complex.

  • Lack of mnhB2 Documentation in S. epidermidis:
    No peer-reviewed studies or commercial products specifically mention mnhB2 in S. epidermidis. Genomic databases (e.g., NCBI, UniProt) also lack entries for this protein in S. epidermidis.

Related Proteins in S. epidermidis

While mnhB2 is not documented, S. epidermidis expresses structurally or functionally analogous proteins:

ProteinFunctionRelevance to mnhB2Source
EmbpExtracellular matrix bindingFibronectin adhesion; biofilm formation
SdrGFibrinogen bindingImmune evasion; clotting interference
SesYPlasminogen/plasmin interactionInhibits fibrin degradation

Research Gaps and Hypotheses

  • Horizontal Gene Transfer:
    S. epidermidis frequently acquires mobile genetic elements (e.g., SCCmec, ICEs) . If mnhB2 exists in S. epidermidis, it may reside on an uncharacterized genomic island.

  • Functional Homologs:
    Proteins like Embp (1 MDa extracellular adhesin) share structural complexity with mnhB2-associated systems in S. aureus but serve distinct roles .

Technical Challenges in Recombinant Production

  • Expression Systems:
    Recombinant proteins in S. epidermidis often require optimized E. coli or mammalian cell systems due to codon bias and post-translational modification needs .

  • Antiporter Characterization:
    Membrane proteins like mnhB2 are notoriously difficult to purify, requiring detergent solubilization and lipid reconstitution .

Recommendations for Future Research

  1. Genomic Mining:
    Screen S. epidermidis ST2 strains (predominant in infections) for mnhB2-like sequences using whole-genome sequencing .

  2. Functional Studies:
    Use CRISPR-Cas9 to delete putative antiporter genes and assess phenotypic impacts on ion homeostasis or virulence.

  3. Structural Analysis:
    Resolve cryo-EM structures of recombinant mnhB2 (if identified) to compare with S. aureus homologs.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for you.
Synonyms
mnhB2; mrpB2; SERP0282; Putative antiporter subunit mnhB2; Mrp complex subunit B2; Putative NADH-ubiquinone oxidoreductase subunit mnhB2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
mnhB2
Target Protein Sequence
MKENDVVLKSVTKIVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFDVNEV LKSLPIDFKKLMIIGSLISVATASVPMFFGKPFLYQTEANVTFPLLGHVHVTTVTLFELG ILLTVVGVIVTVMLSISGGRS
Uniprot No.

Target Background

Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.