Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhC2 (mnhc2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Staphylococcus epidermidis

MnhC2 belongs to a family of cation/proton antiporters that play crucial roles in bacterial physiology. Based on information about similar antiporter systems, particularly in S. aureus, these antiporters are typically composed of clusters of seven hydrophobic membrane-bound protein subunits . The MnhC2 subunit functions as part of this larger complex known as the Mnh antiporter system.

The primary function of antiporter systems like Mnh is to maintain ion homeostasis and pH regulation within bacterial cells. By exchanging cations (such as Na⁺, K⁺, or other ions) for protons (H⁺), these systems help bacteria adapt to changing environmental conditions, particularly in high-salt environments or under pH stress.

Role in Ion Transport and Bacterial Survival

The designation of mnhC2 as a "Putative NADH-ubiquinone oxidoreductase subunit" suggests a potential connection to energy metabolism processes . This dual role—in both ion transport and potentially in energy coupling—highlights the sophisticated integration of cellular functions in bacterial systems.

While specific experimental data on the precise function of S. epidermidis mnhC2 is limited in the available search results, insights can be drawn from studies of homologous systems. In S. aureus, for example, Mnh antiporters have been implicated in salt tolerance and pH homeostasis . Given the close relationship between these staphylococcal species, similar functions can be reasonably inferred for the S. epidermidis Mnh system, of which mnhC2 is a component.

Recombinant Production and Characteristics

The recombinant form of S. epidermidis mnhC2 protein has been produced for research and potential biotechnological applications. Production of this recombinant protein can be accomplished using various expression systems including E. coli, yeast, baculovirus, or mammalian cells . Each expression system offers distinct advantages in terms of protein folding, post-translational modifications, and yield.

Relationship to Bacterial Pathogenicity and Clinical Significance

Staphylococcus epidermidis is increasingly recognized as an important opportunistic pathogen, particularly in healthcare-associated infections. While traditionally considered less virulent than S. aureus, S. epidermidis is a frequent cause of bloodstream infections, especially in immunocompromised patients and those with indwelling medical devices.

Epidemiology and Antibiotic Resistance

S. epidermidis isolates from clinical settings frequently exhibit antibiotic resistance. In a long-term study of bloodstream infections in patients with hematological malignancies, 78% of S. epidermidis isolates demonstrated methicillin resistance . The predominant sequence types (STs) observed were ST2 and ST215, with methicillin resistance detected in 95% of these isolates, compared to only 34% in other sequence types .

While the direct role of mnhC2 in antibiotic resistance has not been explicitly established in the available search results, membrane transport systems like antiporters can potentially contribute to bacterial survival under antibiotic stress by maintaining cellular homeostasis.

Genetic Mobility and Horizontal Gene Transfer

S. epidermidis serves as an important reservoir of mobile genetic elements that can be transferred to more virulent species like S. aureus. For example, the arginine catabolic mobile element (ACME), which enhances bacterial capacity to grow and survive within hosts, appears to have been transferred from S. epidermidis to the highly virulent USA300 MRSA clone .

This genetic mobility demonstrates the clinical importance of understanding S. epidermidis proteins, including membrane components like mnhC2, as they may ultimately contribute to virulence mechanisms in multiple staphylococcal species through horizontal gene transfer events.

Potential Applications and Future Research Directions

Recombinant S. epidermidis mnhC2 protein has several potential applications in research and biotechnology. As a component of a membrane transport system, it serves as a valuable target for studying bacterial adaptation mechanisms to various environmental stresses.

Research Applications

The recombinant protein can be utilized in:

  • Structural studies to elucidate the precise mechanism of ion transport

  • Development of inhibitors that might disrupt ion homeostasis in pathogenic staphylococci

  • Investigation of protein-protein interactions within the Mnh antiporter complex

  • Comparative studies with homologous proteins from other bacterial species

Therapeutic Potential

Membrane proteins like mnhC2 represent potential targets for novel antimicrobial strategies. As components of essential cellular processes, disruption of antiporter function could potentially compromise bacterial viability or virulence. Additionally, as surface-exposed proteins, antiporter components might serve as targets for vaccine development strategies, although this application requires further investigation.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mnhC2; mrpC2; SERP0283; Putative antiporter subunit mnhC2; Mrp complex subunit C2; Putative NADH-ubiquinone oxidoreductase subunit mnhC2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
mnhC2
Target Protein Sequence
MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGKYGPHMSEPLIQG HAQNFVDPLLQAIVLTAIVIGFGMTAFLLVLIYRTYRVTKEDEISALKGDEDDE
Uniprot No.

Target Background

Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit C family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.