Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhF2 (mnhF2)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Staphylococcus epidermidis putative antiporter subunit mnhF2 (UniProt ID: Q8CQ45) is a His-tagged, full-length protein (1–100 amino acids) expressed in E. coli. This protein belongs to the Mrp (Multiple Resistance and pH) antiporter family, which facilitates cation/proton exchange to maintain cellular pH homeostasis and ion balance. Key properties include:

PropertyDetails
Source OrganismStaphylococcus epidermidis (strain ATCC 35984 / RP62A)
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Molecular Weight~11 kDa (calculated)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 50% glycerol recommended

Functional Roles and Mechanisms

MnhF2 is part of the Mrp antiporter complex (subunits A–G), which mediates Na⁺/H⁺ and K⁺/H⁺ exchange to counteract alkaline stress and maintain membrane potential . In S. epidermidis, this system is critical for:

  • pH homeostasis during infection or biofilm formation.

  • Antibiotic resistance (e.g., methicillin resistance in MRSE strains) via ion balance regulation .

Key Findings

  • Ion Transport: Mrp antiporters in Staphylococcus aureus exhibit Na⁺/H⁺ (Mnh1) and Na⁺/H⁺/K⁺ (Mnh2) activities . MnhF2 likely shares similar cation specificity.

  • Pathogenesis: S. epidermidis MRSE strains (e.g., ST2, ST59) often harbor SCCmec cassettes and exhibit multidrug resistance . MnhF2 may contribute to survival under antibiotic-induced stress.

Research Applications and Experimental Uses

The recombinant mnhF2 protein is utilized in:

ApplicationDetails
Structural StudiesX-ray crystallography or cryo-EM to resolve antiporter conformation
Functional AssaysNa⁺/H⁺ exchange activity in everted vesicles
Immunological StudiesWestern blotting for detecting antiporter expression in clinical isolates
Therapeutic TargetingScreening inhibitors of cation/proton antiporters in S. epidermidis

Role in S. epidermidis Pathogenesis

  • Biofilm Formation: Acidic byproducts of metabolism may require MnhF2-mediated pH regulation .

  • Antibiotic Resistance: Co-regulation with SCCmec elements in MRSE strains .

MRSE vs. MSSE Strains

ParameterMRSEMSSE
SCCmec TypePredominantly III (ST2) or IV (ST59) Absent
ACME Prevalence~67.7% ~83.3%
Clinical VirulenceHigh (e.g., ST2) Low

MnhF2 vs. Mnh1/Mnh2 in S. aureus

FeatureMnhF2 (S. epidermidis)Mnh1 (S. aureus)Mnh2 (S. aureus)
Primary CationNa⁺/H⁺ (predicted) Na⁺/H⁺ Na⁺/H⁺ and K⁺/H⁺
pH OptimumAlkaline Neutral (pH 7.5) Alkaline (pH 8.5–9.5)
Virulence RoleUndeterminedCritical for infection survival Minimal impact on virulence

Challenges and Future Directions

  • Structural Validation: AlphaFold models (pLDDT > 90) require experimental confirmation .

  • Functional Specificity: Direct evidence linking mnhF2 to Na⁺/H⁺ transport in S. epidermidis is lacking.

  • Therapeutic Potential: Targeting Mrp antiporters may disrupt pH-dependent virulence strategies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mnhF2; mrpF2; SERP0286; Putative antiporter subunit mnhF2; Mrp complex subunit F2; Putative NADH-ubiquinone oxidoreductase subunit mnhF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
mnhF2
Target Protein Sequence
MIEMFTQIFIISALVIFGMALLVCLVRLIKGPTTADRVVSFDASSAVVMSIVGVMSVIFN SVSYLDSIMLIAIISFVSSVSISRFIGEGRVFNGNHKRHR
Uniprot No.

Target Background

Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit F family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the putative antiporter subunit mnhF2 in Staphylococcus epidermidis and how does it relate to other bacterial antiporters?

The putative antiporter subunit mnhF2 in Staphylococcus epidermidis is a component of a multi-subunit Na⁺/H⁺ antiporter system similar to the Mrp (multiple resistance and pH) antiporter complexes found in Bacillus species. These antiporter systems function in ion homeostasis, playing crucial roles in pH regulation and salt tolerance.

Based on comparative studies with Bacillus species, these antiporter systems demonstrate both secondary and primary energization capacities, which is unexpected for what were traditionally considered completely secondary active transporters . Unlike single-protein antiporters such as NhaA from E. coli, the multi-subunit systems like those containing mnhF2 exhibit higher protonophore resistance and greater efficacy in supporting Na⁺ resistance under various growth conditions .

The full-length mnhF2 protein is relatively small (approximately 100 amino acids) and studies typically utilize recombinant versions with N-terminal His-tags to facilitate purification and functional analysis .

What expression systems are most effective for producing recombinant S. epidermidis mnhF2 protein?

For laboratory-scale production of recombinant S. epidermidis mnhF2 protein, E. coli expression systems have proven particularly effective. The methodological approach typically involves:

  • Cloning the mnhF2 gene into a low-copy plasmid vector with an inducible promoter

  • Addition of an N-terminal His-tag for purification purposes

  • Expression in E. coli strains optimized for membrane protein production

Current literature indicates successful expression of the full-length putative antiporter subunit mnhF2 (amino acids 1-100) in E. coli systems . The expression protocol often involves:

  • Culture growth at 30-37°C until mid-log phase

  • Induction with IPTG at concentrations between 0.1-1.0 mM

  • Post-induction growth at lower temperatures (16-25°C) to enhance proper folding

  • Cell harvesting and membrane fraction isolation through differential centrifugation

For studying antiporter function specifically, E. coli mutant strains lacking endogenous Na⁺/H⁺ antiporters (such as the KNabc strain used in studies of related antiporters) provide clean backgrounds for functional assays .

How can researchers verify the functional activity of recombinant mnhF2?

Verifying the functional activity of recombinant mnhF2 requires multiple complementary approaches:

1. Fluorescence-based vesicle assays:
Similar to methods used for other bacterial antiporters, researchers can prepare inverted membrane vesicles containing the recombinant protein and monitor ion exchange using pH-sensitive or Na⁺-sensitive fluorescent probes. This approach allows for quantitative assessment of antiport activity under controlled conditions .

2. Whole-cell Na⁺ exclusion assays:
Expressing mnhF2 (likely as part of a complete antiporter complex) in antiporter-deficient E. coli strains and measuring their ability to exclude Na⁺ under various conditions, including in the presence of protonophores. Based on studies with related systems, mnhF2-containing complexes would be expected to confer significant protonophore resistance compared to single-subunit antiporters like NhaA .

3. Growth complementation assays:
Evaluating the ability of recombinant mnhF2 (as part of its functional complex) to restore growth of antiporter-deficient bacterial strains under high Na⁺ conditions or in media with altered pH. The efficacy can be assessed under both aerobic and anaerobic conditions, with particular attention to non-fermentative growth conditions where these systems show distinctive advantages .

4. Electron donor-dependent activity testing:
Since related antiporter systems show electron donor-dependent activity, researchers should assess mnhF2-containing complexes for activity differences when various electron donors are provided in the experimental system .

How does growth phase affect the expression and function of mnhF2 in S. epidermidis?

Growth phase significantly impacts the expression and function of membrane proteins in S. epidermidis, which likely extends to mnhF2. Based on studies of other S. epidermidis membrane components, researchers should consider the following methodological approaches:

Growth phase-dependent expression analysis:

  • Culturing S. epidermidis under standardized conditions

  • Harvesting cells at defined time points representing exponential and stationary phases

  • Quantifying mnhF2 expression through RT-qPCR

  • Performing Western blot analysis with antibodies against mnhF2 or its epitope tag

Studies with S. epidermidis have demonstrated that stationary phase cells show increased expression of certain cell surface proteins compared to exponential phase cells. For example, the expression of SdrG, a cell surface adhesion protein, was upregulated approximately twofold in stationary versus exponential phase . This suggests that mnhF2 might likewise show growth phase-dependent expression patterns.

Growth phase also affects S. epidermidis surface charge, which can influence protein interactions and function . Researchers should characterize the surface charge properties of S. epidermidis at different growth phases using:

  • Zeta potential measurements

  • Microbial adhesion to hydrocarbons (MATH) assays

  • Electrophoretic mobility assessments

A comparative analysis protocol for growth phase-dependent properties might include:

Growth PhaseCell Density MeasurementSurface Charge AnalysismnhF2 Expression LevelAntiporter Activity Assay
Early exponentialHemacytometer count + OD₆₀₀Zeta potentialRT-qPCR + Western blotFluorescence-based vesicle assay
Mid-exponentialHemacytometer count + OD₆₀₀Zeta potentialRT-qPCR + Western blotFluorescence-based vesicle assay
Late exponentialHemacytometer count + OD₆₀₀Zeta potentialRT-qPCR + Western blotFluorescence-based vesicle assay
Early stationaryHemacytometer count + OD₆₀₀Zeta potentialRT-qPCR + Western blotFluorescence-based vesicle assay
Late stationaryHemacytometer count + OD₆₀₀Zeta potentialRT-qPCR + Western blotFluorescence-based vesicle assay

What purification strategies yield the highest activity of recombinant mnhF2 protein?

Purifying membrane proteins while maintaining their native conformation and activity presents significant challenges. For recombinant mnhF2, researchers should consider:

Optimized membrane extraction:

  • Cell lysis via French press or sonication in buffer containing:

    • 50 mM Tris-HCl (pH 7.5)

    • 150-300 mM NaCl

    • Protease inhibitor cocktail

    • 10% glycerol as a stabilizing agent

  • Differential centrifugation to isolate membrane fractions

  • Solubilization using mild detergents such as:

    • n-Dodecyl β-D-maltoside (DDM) at 1-2%

    • Digitonin at 1%

    • CHAPS at 0.5-1%

Affinity purification strategy:
For His-tagged recombinant mnhF2 :

  • Nickel or cobalt affinity chromatography using buffers containing:

    • The chosen detergent at concentrations above its critical micelle concentration

    • 20-50 mM imidazole in the wash buffer

    • 250-500 mM imidazole for elution

  • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Optional ion exchange chromatography for additional purity

Activity preservation considerations:

  • Maintain 10-15% glycerol throughout purification

  • Include specific lipids (e.g., E. coli polar lipids) during purification to stabilize the protein

  • Consider purification at 4°C to minimize degradation

  • Test activity at each purification step to track activity loss

Reconstitution for functional studies:

  • Incorporation into liposomes via detergent dialysis or rapid dilution

  • Composition of liposomes:

    • E. coli polar lipids or defined mixtures of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin

    • Lipid-to-protein ratio optimization between 50:1 and 200:1

  • Verification of orientation in liposomes using protease accessibility assays

How can researchers distinguish between primary and secondary energization capacities of mnhF2-containing antiporter complexes?

Based on studies of related Mrp antiporter systems, mnhF2-containing complexes may possess both secondary (utilizing pre-existing ion gradients) and primary (directly coupled to energy input) energization capacities . Distinguishing between these mechanisms requires specialized experimental approaches:

Comparative energetics analysis:

  • Inside-out membrane vesicle preparation from cells expressing mnhF2-containing complexes

  • Parallel assays with established primary (F₁F₀-ATPase) and secondary (NhaA) transporters as controls

  • Assessment of antiport activity under conditions that selectively inhibit:

    • Respiratory chain components (using specific inhibitors)

    • ATP synthesis (using DCCD or similar F₁F₀-ATPase inhibitors)

    • Pre-existing ion gradients (using ionophores)

Protonophore resistance testing:

  • Whole-cell Na⁺ exclusion assays in the presence of increasing concentrations of protonophores (e.g., CCCP)

  • Comparison of IC₅₀ values for mnhF2-containing complexes versus known secondary antiporters like NhaA

  • Analysis of mnhF2 activity retention under conditions where secondary transport should be compromised

Based on studies with related systems, mnhF2-containing complexes would be expected to show:

  • Greater protonophore resistance than typical secondary antiporters

  • Enhanced efficacy in supporting growth under conditions where solely secondary transporters are less effective

  • Possible direct interaction with electron transport chain components

Electron donor dependency analysis:

  • Assessment of antiport activity with various electron donors:

    • NADH

    • Succinate

    • Specific respiratory substrates

  • Comparison of activity in wild-type versus respiratory-deficient strains

  • Measurement of antiport activity coupling to redox reactions

Experimental ConditionExpected Result for Secondary TransporterExpected Result for Primary/Secondary Hybrid
High protonophore concentrationSevere activity reductionPartial activity retention
ATP depletionMinimal direct effectSignificant activity reduction
Respiratory inhibitorsIndirect effect via proton gradientDirect activity reduction
Anaerobic conditionsReduced activityBetter activity maintenance
Support of non-fermentative growthLimited capabilityEnhanced capability

What role might mnhF2 play in S. epidermidis biofilm formation and pathogenicity?

S. epidermidis is a common cause of device-related infections due to its biofilm-forming capacity, which provides protection from antibiotics and host immune responses . The potential role of mnhF2 in this context can be investigated through:

Biofilm formation assays:

  • Construction of mnhF2 knockout and overexpression strains

  • Quantitative assessment of biofilm formation using:

    • Crystal violet staining

    • Confocal laser scanning microscopy with fluorescent indicators

    • Biofilm thickness and architecture analysis

  • Evaluation under varying conditions:

    • Different pH levels

    • Various salt concentrations

    • Growth on different surfaces (polystyrene, glass, medical-grade materials)

Interaction with host proteins:
S. epidermidis shows growth phase-dependent affinity for host proteins like fibrinogen , which may involve changes in membrane protein expression or function. To investigate mnhF2's potential role:

  • Flow cytometry analysis of wild-type versus mnhF2-modified strains incubated with fluorescently labeled host proteins

  • Surface plasmon resonance to quantify direct interactions

  • Continuous flow adhesion assays to assess bacterial deposition onto protein-coated surfaces

Ion homeostasis during host colonization:

  • Measurement of intracellular Na⁺, K⁺, and pH in wild-type versus mnhF2-modified strains during:

    • Biofilm formation

    • Exposure to host defense molecules

    • Growth under conditions mimicking the in vivo environment

  • Assessment of survival under ionic stress conditions relevant to host environments

Virulence model testing:

  • Catheter-associated infection models comparing wild-type and mnhF2-modified strains

  • Evaluation of bacterial persistence, biofilm formation, and host inflammatory response

  • Assessment of antibiotic susceptibility in biofilms formed by different strains

What structural features of mnhF2 are critical for its function within the antiporter complex?

Understanding the structure-function relationship of mnhF2 requires both computational and experimental approaches:

Sequence analysis and structural prediction:

  • Multiple sequence alignment with homologous proteins from related species

  • Identification of conserved residues and motifs

  • Secondary structure prediction using algorithms optimized for membrane proteins

  • Transmembrane topology prediction using methods such as:

    • TMHMM

    • Phobius

    • MEMSAT

  • Homology modeling based on related proteins with known structures

Site-directed mutagenesis strategy:

  • Targeting of:

    • Conserved residues identified through sequence analysis

    • Predicted transmembrane domains

    • Potential ion-binding sites

    • Interface regions for interaction with other subunits

  • Construction of a mutation library using overlapping PCR or similar methods

  • Functional assessment of mutants through complementation assays and direct activity measurements

Protein-protein interaction analysis:
Since mnhF2 likely functions as part of a multi-subunit complex:

  • Bacterial two-hybrid or split-ubiquitin assays to map interactions with other subunits

  • Co-immunoprecipitation studies using tagged versions of different subunits

  • Chemical cross-linking followed by mass spectrometry to identify interaction interfaces

Structural studies:

  • Cryo-electron microscopy of the purified complex

  • X-ray crystallography of individual domains or the entire complex

  • Solid-state NMR studies of reconstituted protein in lipid environments

Domain/RegionPredicted FunctionExperimental Approach for Validation
Transmembrane helicesIon translocationCysteine scanning mutagenesis with accessibility studies
Conserved charged residuesIon coordinationSite-directed mutagenesis + functional assays
Cytoplasmic domainsInteraction with other subunits or energy couplingTruncation analysis and interaction studies
Periplasmic regionsPotential regulatory functionsDomain swapping with related proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.