Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhG2 (mnhG2)

Shipped with Ice Packs
In Stock

Description

General Information

Staphylococcus epidermidis is a coagulase-negative bacterium commonly found on human skin . While often considered a harmless commensal, S. epidermidis can cause serious infections, particularly in individuals with compromised immune systems or indwelling medical devices . Understanding the molecular mechanisms that contribute to the survival and virulence of S. epidermidis is crucial for developing effective strategies to combat these infections.

Protein Structure and Function

MnhG2 is a subunit of a putative antiporter complex, which is involved in the transport of ions across the cell membrane . Antiporters are integral membrane proteins that facilitate the exchange of one ion for another, playing a critical role in maintaining cellular pH, ion balance, and nutrient transport.

Homology and Evolutionary Significance

MnhG2 shows similarity to other MnhG subunits found in various bacterial species . This sequence homology suggests that MnhG2 is functionally conserved and plays a similar role in ion transport across different bacterial species.

Role in Virulence and Pathogenicity

S. epidermidis can cause a variety of infections, including bloodstream infections, wound infections, and infections associated with indwelling medical devices . Although MnhG2 is not directly identified as a virulence factor, its contribution to bacterial survival and adaptation to different environmental conditions may indirectly influence the pathogenicity of S. epidermidis.

Research and Future Directions

Further research is needed to fully understand the function of MnhG2 and its role in the physiology and pathogenesis of S. epidermidis. Future studies might focus on:

  • Determining the specific ions transported by the MnhG2-containing antiporter complex. This would provide insights into the physiological role of the antiporter in S. epidermidis.

  • Investigating the regulation of MnhG2 expression under different environmental conditions. This could reveal how S. epidermidis adapts to different stresses and maintains cellular homeostasis during infection.

  • Characterizing the interactions of MnhG2 with other proteins and molecules in S. epidermidis. This could identify potential targets for novel antimicrobial agents.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To prioritize a specific tag, please inform us during your order placement.
Synonyms
mnhG2; mrpG2; SERP0287; Putative antiporter subunit mnhG2; Mrp complex subunit G2; Putative NADH-ubiquinone oxidoreductase subunit mnhF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
mnhG2
Target Protein Sequence
MEIIKDIVSLIASILIFLGSIIALISAIGIVKFQDVFLRSHASTKSSTLSVLLTVVGVLI YFIVNSGFFSVRLLLSLVFINLTSPVGMHLISRAAYRNGAYMYRKDDASRQSTILLSQKE FNTPEELKKRAKLREERREKLYYKEKEYINKMDD
Uniprot No.

Target Background

Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit G family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the putative antiporter subunit mnhG2 in Staphylococcus epidermidis?

The mnhG2 protein is a subunit of what appears to be a multisubunit cation/proton antiporter system in Staphylococcus epidermidis. Based on research in related species like S. aureus, these antiporters typically consist of seven hydrophobic membrane-bound protein subunits that work together to exchange cations (such as Na+ or K+) for protons across the bacterial membrane . The "G2" designation likely indicates it's part of a second antiporter complex (similar to how S. aureus has both Mnh1 and Mnh2 systems).

How does mnhG2 compare to antiporter systems in other Staphylococcus species?

In Staphylococcus aureus, there are two distinct Mnh antiporter systems (Mnh1 and Mnh2) that play important roles in maintaining cytoplasmic pH and enabling survival under environmental stress . The Mnh1 antiporter in S. aureus primarily exchanges Na+/H+ cations at pH 7.5, while Mnh2 exchanges both Na+/H+ and K+/H+ cations, particularly at pH 8.5 . The putative mnhG2 subunit in S. epidermidis likely performs similar functions as part of a multisubunit complex, though specific differences may exist due to the different ecological niches these bacteria occupy, with S. epidermidis being primarily a skin commensal .

What is the predicted structure and membrane topology of mnhG2?

While specific structural data for S. epidermidis mnhG2 is not detailed in the search results, we can infer based on homologous proteins in related species that it likely contains multiple transmembrane domains. As part of a seven-subunit antiporter complex, mnhG2 would be expected to be a hydrophobic integral membrane protein with several membrane-spanning helices . The "G" subunit typically contributes to the ion transport pathway and may be involved in the actual translocation of ions across the membrane.

How can expression patterns of mnhG2 be monitored during infection or under different environmental conditions?

Monitoring mnhG2 expression requires sophisticated methods similar to those used for other staphylococcal membrane proteins. Researchers can utilize:

  • Quantitative RT-PCR: To measure mnhG2 transcript levels under various conditions, similar to how sdrG transcript levels were measured following shifts from in vitro to in vivo conditions .

  • Immunofluorescence microscopy: For protein-level detection, as demonstrated with SdrG in S. epidermidis, where protein expression increased following exposure to the bloodstream .

  • Flow cytometry: To quantify surface expression on bacterial cells under different environmental conditions .

  • In vivo expression models: Similar to how researchers detected SdrG expression in mouse bloodstream conditions, mnhG2 expression could be monitored by exposing S. epidermidis to relevant host environments and then measuring transcript or protein levels .

It's worth noting that expression may change dramatically in response to specific host environmental signals - for instance, SdrG expression in S. epidermidis increased within 1 hour following exposure to mouse bloodstream conditions despite not being detectable during growth in nutrient broth or human serum .

What methodologies can be used to characterize the ion specificity and transport kinetics of the mnhG2-containing antiporter complex?

Researchers can characterize the ion specificity and transport kinetics using techniques similar to those employed for the S. aureus Mnh antiporters:

  • Everted (inside-out) membrane vesicle assays: These can be prepared from bacterial cells expressing the recombinant antiporter complex to measure cation/proton exchange activities .

  • Heterologous expression systems: Cloning the entire mnhG2-containing operon into an antiporter-deficient strain (such as E. coli KNabc) allows functional studies in a controlled genetic background .

  • Ion-selective electrodes or fluorescent probes: These can be used to measure the movement of specific ions (Na+, K+, H+) in real-time.

  • pH-dependent activity assays: To determine optimal pH ranges for antiporter function, similar to how Mnh1 and Mnh2 in S. aureus were found to have different pH optima (pH 7.5 for Mnh1 and pH 8.5 for Mnh2) .

How can genetic manipulation techniques be optimized for studying mnhG2 function in S. epidermidis?

To effectively study mnhG2 function in S. epidermidis, researchers can employ these genetic approaches:

  • Gene deletion strategies: Creating mnhG2 deletion mutants through homologous recombination or CRISPR-Cas9 techniques, similar to how mnhA1 and mnhA2 deletions were created in S. aureus .

  • Complementation studies: Reintroducing the wild-type mnhG2 gene on a plasmid to confirm phenotypes are specifically due to the deletion.

  • Site-directed mutagenesis: To identify critical residues for ion specificity or transport function.

  • Reporter gene fusions: Constructing mnhG2 promoter-reporter fusions to monitor gene expression under different conditions.

  • Inducible expression systems: To control mnhG2 expression levels and study dose-dependent effects.

When performing these manipulations, researchers should consider the challenges specific to S. epidermidis, which can be more difficult to transform than S. aureus due to robust biofilm formation and different restriction-modification systems.

What are the optimal conditions for expressing and purifying recombinant mnhG2 for structural studies?

For optimal expression and purification of recombinant mnhG2:

  • Expression system selection: Consider using specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3)) as membrane proteins are often toxic when overexpressed.

  • Expression tags: Incorporate affinity tags (His6, FLAG, etc.) at positions least likely to interfere with protein folding – typically at the N- or C-terminus depending on predicted topology.

  • Induction conditions: Optimize temperature (often lower temperatures like 16-20°C improve membrane protein folding), inducer concentration, and duration for maximum functional protein yield.

  • Detergent screening: Test a panel of detergents for efficient extraction from membranes while maintaining protein stability and function.

  • Purification strategy: Implement a multi-step approach including affinity chromatography, size exclusion, and ion exchange steps to achieve high purity.

  • Stability assessment: Monitor protein stability through thermal shift assays or limited proteolysis to identify optimal buffer conditions for structural studies.

For structural studies specifically, researchers may need to reconstitute the purified protein into nanodiscs, liposomes, or other membrane mimetics that better preserve native conformation.

How should researchers design experiments to investigate mnhG2's contribution to S. epidermidis salt tolerance and pH homeostasis?

To investigate mnhG2's role in salt tolerance and pH homeostasis:

  • Growth curve analysis: Compare growth of wild-type, mnhG2 deletion mutant, and complemented strains under various salt concentrations (NaCl, KCl) and pH values, similar to the approach used for S. aureus Mnh1 and Mnh2 .

  • pH sensitivity assays: Measure survival rates at different external pH values (pH 5.5-9.5) to determine the range where mnhG2 is most critical.

  • Intracellular pH measurement: Use pH-sensitive fluorescent probes to monitor internal pH when cells are subjected to salt or pH challenges.

  • Ion uptake studies: Measure Na+ and K+ accumulation using atomic absorption spectroscopy or isotope-labeled ions.

  • Membrane potential measurements: Use potential-sensitive dyes to determine if mnhG2 deletion affects membrane energetics.

The experimental design should include appropriate controls and consider potential compensatory mechanisms from other antiporters or ion transport systems. Based on findings from S. aureus, researchers should pay particular attention to conditions combining elevated salt and alkaline pH, as the Mnh2 system (which would include mnhG2) showed significant growth effects primarily in the pH range of 8.5-9.5 under high salt conditions .

What animal models are appropriate for studying the role of mnhG2 in S. epidermidis colonization and infection?

When selecting animal models to study mnhG2's role in colonization and infection:

  • Skin colonization models: Since S. epidermidis is primarily a skin commensal , models that replicate human skin conditions would be appropriate for colonization studies.

  • Catheter-associated infection models: Given S. epidermidis' importance in device-related infections, implanting catheters or other medical devices in mice or rats can model biofilm formation.

  • Bacteremia models: Similar to the models used for studying SdrG expression, intravenous infection can assess the role of mnhG2 in bloodstream survival and virulence .

  • Wound infection models: To study S. epidermidis in compromised skin conditions.

For any model, comparisons should include wild-type S. epidermidis, mnhG2 deletion mutants, and complemented strains. Researchers should monitor bacterial load, tissue damage, immune response, and expression levels of mnhG2 during infection. Based on findings in S. aureus, where mnhA1 deletion led to major loss of virulence in mice while mnhA2 deletion did not , researchers should be prepared for the possibility that different components of the antiporter system may have varying contributions to virulence.

How can researchers distinguish between direct effects of mnhG2 deletion and indirect effects from compensatory mechanisms?

Distinguishing direct from indirect effects requires careful experimental design and analysis:

  • Temporal studies: Monitor gene expression changes immediately after mnhG2 deletion versus long-term adaptation.

  • Global transcriptome analysis: Use RNA-seq to identify genes with altered expression following mnhG2 deletion, which may indicate compensatory pathways.

  • Proteomics approach: Compare membrane protein profiles between wild-type and mutant strains to identify changes in other transporters.

  • Metabolomics analysis: Assess changes in metabolic profiles that might indicate shifts in cellular physiology.

  • Double/triple knockout studies: Create mutants lacking multiple antiporter systems to reveal functional redundancy, similar to the double deletion of mnhA1 and mnhA2 in S. aureus that showed more severe phenotypes than single deletions .

  • Complementation controls: Use inducible expression systems to reintroduce mnhG2 at various levels and determine which phenotypes are directly restored.

Remember that antiporter systems often have overlapping functions, as seen in S. aureus where both Mnh1 and Mnh2 contributed to pH and salt tolerance but with different optima .

What statistical approaches are most appropriate for analyzing phenotypic differences between wild-type and mnhG2 mutant strains?

When analyzing phenotypic differences:

  • Growth curve analysis: Use area under the curve (AUC) calculations, maximum growth rate, and lag phase comparisons with appropriate statistical tests (t-tests or ANOVA with post-hoc tests).

  • Survival assays: Apply Kaplan-Meier survival analysis for time-to-death experiments in stress conditions.

  • Repeated measures designs: For experiments tracking the same bacterial populations over time.

  • Multiple comparison corrections: Implement Bonferroni or false discovery rate corrections when testing multiple conditions.

  • Regression models: For complex experiments with multiple variables (pH, salt concentration, temperature, etc.).

  • Power analysis: Conduct beforehand to ensure sufficient replication for detecting biologically relevant differences.

For in vivo experiments, mixed-effects models may be appropriate to account for individual animal variation while testing for treatment effects.

How should contradictory findings between in vitro and in vivo expression of mnhG2 be reconciled?

Reconciling contradictory findings between in vitro and in vivo contexts:

  • Environmental complexity assessment: Consider that the in vivo environment contains multiple signals that may not be replicated in vitro. This was demonstrated with SdrG in S. epidermidis, where expression increased in mouse bloodstream but not in human serum or other in vitro conditions meant to mimic in vivo environments .

  • Temporal dynamics: Examine expression patterns at multiple time points, as expression may be transient or phase-dependent.

  • Spatial heterogeneity: Within a host, bacteria may experience different microenvironments leading to population heterogeneity in gene expression.

  • Host-specific factors: Test multiple host systems as responses may differ between animal models and humans.

  • Integrated multi-omics approach: Combine transcriptomics, proteomics, and metabolomics data from both settings to identify potential regulatory mechanisms explaining the differences.

  • Single-cell analysis: Technologies like single-cell RNA-seq can reveal heterogeneity within bacterial populations that may explain seemingly contradictory population-level measurements.

When faced with contradictions, researchers should consider the possibility that mnhG2 expression might be specifically triggered by complex combinations of host signals rather than by any single factor that can be easily replicated in vitro .

What are promising approaches for developing inhibitors targeting mnhG2 as potential antimicrobial agents?

Developing inhibitors targeting mnhG2 could follow these approaches:

  • Structure-based drug design: Once structural information is available, computational methods can identify small molecules that bind to critical regions of mnhG2.

  • High-throughput screening: Test compound libraries for molecules that specifically inhibit mnhG2-containing antiporter function.

  • Peptide inhibitors: Design peptides that mimic natural substrates or interaction partners of mnhG2.

  • Combination approaches: Develop inhibitors that simultaneously target multiple components of the antiporter complex for enhanced efficacy.

  • Adjuvant potential: Explore whether mnhG2 inhibition might potentiate existing antibiotics by compromising bacterial pH homeostasis.

Researchers should consider the homology between S. epidermidis mnhG2 and related proteins in other species to ensure specificity, while also recognizing that the role of mnhG2 in virulence may differ from what was observed with mnhA1 in S. aureus .

How might research on mnhG2 contribute to understanding S. epidermidis' dual role as both commensal and opportunistic pathogen?

Research on mnhG2 could illuminate S. epidermidis' dual lifestyle by:

  • Comparative expression analysis: Compare mnhG2 expression levels in commensal versus pathogenic states to determine if upregulation correlates with virulence.

  • Host interaction studies: Examine whether mnhG2-mediated pH adaptation affects interactions with host immune cells or epithelial surfaces.

  • Biofilm contribution: Investigate whether mnhG2 plays a role in biofilm formation, which is critical for both commensalism and pathogenicity .

  • Ecological competition: Study how mnhG2 might contribute to competition with other skin microbes in both health and disease states.

  • Strain variation analysis: Compare mnhG2 sequences and expression patterns across commensal and clinical S. epidermidis isolates to identify potential adaptations associated with pathogenicity.

Understanding how antiporter systems like mnhG2 contribute to adaptation in various host environments may reveal how S. epidermidis transitions between its beneficial commensal role in skin health and its harmful role in opportunistic infections .

What technological advances would facilitate better characterization of multi-subunit membrane protein complexes like the mnhG2-containing antiporter?

Technological advances that would enhance research on mnhG2 include:

  • Cryo-electron microscopy improvements: Enhanced resolution for membrane protein structures without crystallization.

  • Advanced mass spectrometry: Native mass spectrometry and hydrogen-deuterium exchange techniques for studying intact membrane protein complexes.

  • Single-molecule biophysics: Techniques like single-molecule FRET to observe conformational changes during transport cycles.

  • Microfluidic systems: For precise control of environmental conditions during live-cell imaging of transport activity.

  • Computational advances: Improved molecular dynamics simulations to model ion transport through complex membrane protein assemblies.

  • Synthetic biology approaches: Engineering simplified versions of the antiporter complex to determine minimal functional units.

  • In-cell structural biology: Techniques that allow structural determination in native cellular environments rather than in detergent micelles.

These technological advances would help overcome the significant challenges in studying multisubunit membrane protein complexes like the one containing mnhG2, which are notoriously difficult to express, purify, and characterize.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.