Recombinant Staphylococcus epidermidis Sensor protein kinase walK (walK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and approved in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
walK; yycG; SERP2533; Sensor protein kinase WalK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-610
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
walK
Target Protein Sequence
MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNSLEKELLDNFKKNITQYAKQLDVNI EKVYKDKDKGSVNAQKDIQDLLNEYANRQEIGEIRFIDKDQIIMATTKQSNRGLINQKVN DGSVQKALSLGQTNDHMVLKDYGSGKERVWVYNIPVKVDKQTIGDIYIESKINDVYNQLN NINQIFIVGTAISLFITVILGFFIARTITKPITDMRNQTVEMSKGNYTQRVKIYGNDEIG ELALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGILATDRRGRVRIANDMALKMLGL AKEDVIGYYMLGVLNLENEFSLEEIQENSDSFLLDINEEEGIIARVNFSTIVQETGFVTG YIAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWQDKELAPSFLSV TREETERMIRLVNDLLQLSKMDNESDQITKEIIDFNMFINKIINRHEMAAKDTTFVREIP QQTIFAEIDPDKMTQVFDNVITNAMKYSRGEKRVEFHVKQNALYNRMTIRIKDNGIGIPI NKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPC EIIEDGDWDE
Uniprot No.

Target Background

Function

WalK is a sensor protein kinase belonging to the two-component regulatory system WalK/WalR in Staphylococcus epidermidis. This system regulates genes involved in crucial cellular processes such as autolysis, biofilm formation, and cell wall metabolism. WalK acts as a sensor, undergoing autophosphorylation at a histidine residue before transferring the phosphate group to WalR.

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the walK protein in Staphylococcus epidermidis?

WalK in S. epidermidis is a histidine kinase that functions as the sensor component of the essential WalK/WalR two-component regulatory system. This membrane-bound protein responds to environmental signals by initiating a phosphorylation cascade that ultimately regulates gene expression through its partner response regulator, WalR. The walK protein contains multiple functional domains that facilitate signal detection, transduction, and enzymatic activities necessary for bacterial adaptation .

Based on homology with S. aureus walK, the S. epidermidis version likely plays crucial roles in regulating cell wall metabolism, cell division, and various stress responses. The protein functions through three primary enzymatic activities: autokinase (self-phosphorylation), phosphotransferase (transfer of phosphate to WalR), and phosphatase (removal of phosphate from phosphorylated WalR) .

What are the structural domains of walK protein?

The walK protein contains several distinct functional domains arranged in a modular structure:

DomainApproximate PositionFunction
N-terminal sensing domainaa 1-195Environmental signal detection
Transmembrane domainvariesMembrane anchoring
HAMP domainvariesSignal transduction
Dimerization and Histidine phosphotransfer (DHp) domain~ aa 200-270Contains conserved phosphorylatable histidine
Catalytic and ATP-binding (CA) domain~ aa 271-430ATP binding and autokinase activity
C-terminal tail (CTT)~ aa 431-450Contains W-Acidic motif for WalR interaction

The C-terminal tail, particularly the W-Acidic motif containing a highly conserved tryptophan residue (equivalent to W443 in S. mutans), is critical for WalK-WalR interaction and subsequent signaling processes .

How does walK function as a sensor protein kinase?

WalK functions through a multi-step phosphorelay signaling mechanism:

  • Signal detection: The N-terminal sensing domain detects specific environmental cues.

  • Autokinase activity: Upon signal detection, ATP binds to the CA domain, and WalK autophosphorylates at a conserved histidine residue in the DHp domain.

  • Phosphotransferase activity: The phosphoryl group is transferred from the histidine residue of WalK to an aspartate residue in the receiver domain of WalR.

  • Phosphatase activity: WalK can also dephosphorylate WalR to terminate signaling when necessary.

The W-Acidic motif in the C-terminal tail plays a crucial role in both phosphotransferase and phosphatase activities but not in autokinase activity. This was demonstrated in S. mutans, where mutations in this motif (particularly W443A) maintained normal autokinase activity but significantly reduced phosphotransferase and phosphatase activities .

How is recombinant walK protein typically produced?

Recombinant walK protein can be produced in several expression systems:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapidMay have issues with membrane proteins
YeastBetter for eukaryotic post-translational modificationsSlower, more expensive than E. coli
BaculovirusGood for complex proteinsComplex setup, expensive
Mammalian cellBest for human proteinsMost expensive, lowest yield

For experimental purposes, truncated versions containing only the intracellular domains (e.g., residues 31-450 or 196-450) are often used to overcome challenges associated with membrane protein expression while retaining the catalytic activities .

A typical protocol involves:

  • Gene cloning into an appropriate expression vector with affinity tags (His, GST)

  • Transformation into the chosen expression system

  • Induction of protein expression

  • Cell lysis and protein purification via affinity chromatography

  • Verification of protein purity and activity through SDS-PAGE and enzymatic assays

What is the role of the W-Acidic motif in walK function?

The W-Acidic motif in the C-terminal tail (CTT) of walK is critical for protein-protein interaction with WalR and subsequent signal transduction. Research on S. mutans WalK has identified that the tryptophan residue (W443) in this motif is essential for specific enzymatic activities .

Experimental data from S. mutans WalK research shows:

WalK VariantAutokinase ActivityPhosphotransferase ActivityPhosphatase Activity
Wild-typeNormalNormalNormal
D441ANormalNormalReduced
W443ANormalSignificantly reducedSignificantly reduced
ΔTailNormalSignificantly reducedSignificantly reduced

Isothermal Titration Calorimetry (ITC) measurements demonstrated that wild-type WalK bound to WalR with a Kd of 1.21 μM, while W443A and ΔTail mutants showed undetectable WalR binding . This suggests that the W-Acidic motif provides a critical interaction interface with WalR that is necessary for normal signaling function.

What methods are used to measure walK/walR phosphorylation in vitro and in vivo?

Several complementary methods are employed to study walK/walR phosphorylation:

In vitro methods:

  • Autokinase assays: Purified WalK is incubated with ATP or ATPγS (a non-hydrolyzable ATP analog) and detected via:

    • Anti-thiophosphate antibodies (when using ATPγS)

    • Anti-N1-phosphohistidine antibodies (when using ATP)

    • Radiolabeled ATP (³²P-ATP)

  • Phosphotransferase assays: Measuring the transfer of phosphate from WalK to WalR by:

    • Monitoring reduction in phosphorylated WalK over time

    • Detecting increases in phosphorylated WalR

    • Using ATPγS and anti-thiophosphate antibodies

  • Phosphatase assays: Measuring dephosphorylation of pre-phosphorylated WalR by:

    • Phosphorylating WalR with acetyl phosphate

    • Adding WalK and monitoring WalR dephosphorylation

    • Separating phosphorylated/dephosphorylated forms using Phos-tag SDS-PAGE

In vivo methods:

  • Phos-tag SDS-PAGE of cellular extracts to separate phosphorylated and non-phosphorylated forms

  • Western blotting with phospho-specific antibodies

  • Quantitative mass spectrometry to detect phosphopeptides

The experimental challenges include the intrinsic phosphatase activity of WalK, which can make direct quantification of phosphorylated WalR difficult, requiring careful experimental design and controls .

How does walK interact with different domains of walR?

Research on S. mutans WalK/WalR reveals a complex interaction pattern involving multiple domains:

WalR DomainInteraction with WalKFunctional Significance
Receiver Domain (RD)Weak/undetectable in isolationTraditional phosphorylation site
DNA-Binding Domain (DBD)Strong interaction detectedPreviously unexpected role in signaling
Full-length WalRStrong interaction (Kd = 1.21 μM)Complete functional interaction

GST pull-down experiments demonstrated that the DNA-binding domain (DBD) of WalR interacts with WalK, with the W443 residue being required for this interaction. Interestingly, the interaction with the receiver domain (RD) alone was undetectable, suggesting a more complex interaction mechanism than previously understood .

These findings align with recent research on the KdpDE two-component system in E. coli, indicating that DBD interactions may be more common in bacterial two-component signaling than previously recognized .

What is the impact of walK mutations on bacterial proteome and phenotype?

Mutations in walK, particularly in the CTT region, can have widespread effects on bacterial physiology. Quantitative mass spectrometry analysis of S. mutans comparing wild-type and ΔTail strains revealed:

CategoryNumber of Altered ProteinsNotable Examples and Fold Change
Total detected proteins1,236 (62% of predicted ORFs)-
Significantly altered proteins206-
Major changes (>2× LFQ)39Cell morphology regulator Gps40 (↓14×)
Adhesion protein dextranase (↓7×)
Adhesion protein SpaP (↓7×)
GtfB and GtfC (↓3-6×)
GtfD (↑2×)
GbpC (↓3×)

These proteomic changes translate to alterations in cellular processes including peptidoglycan metabolism, secreted antigens, competence, and biofilm formation. The significant reduction in adhesion proteins and glucan-binding proteins suggests potential impacts on biofilm formation and virulence .

How is walK conservation and variation analyzed across bacterial species?

Analysis of walK conservation involves several comparative approaches:

  • Sequence alignment: Multiple sequence alignment tools (MUSCLE, Clustal Omega) are used to compare walK sequences across species, with particular focus on functional domains and motifs.

  • Phylogenetic analysis: Construction of phylogenetic trees to visualize evolutionary relationships and conservation patterns.

  • Structural homology modeling: Using solved structures (often from model organisms) to predict structural conservation in less-studied species.

  • Functional complementation: Testing whether walK from one species can functionally replace walK in another species.

The high conservation of the W-Acidic motif across Gram-positive bacteria suggests its fundamental importance in walK function. While sensing domains may vary to respond to species-specific environmental signals, the catalytic mechanisms and key interaction motifs tend to be well-conserved .

What experimental approaches are used to study walK signaling pathways?

A comprehensive study of walK signaling requires integration of multiple experimental approaches:

ApproachMethodsInformation Obtained
Biochemical assaysIn vitro kinase, phosphotransferase, and phosphatase assaysEnzymatic mechanisms and kinetics
Protein-protein interactionGST pull-down, ITC, FRET, co-immunoprecipitationPhysical interactions and binding affinities
Genetic manipulationGene deletion, point mutations, complementationIn vivo functional roles
Structural biologyX-ray crystallography, NMR, cryo-EMMolecular structure and conformation
Omics approachesTranscriptomics, proteomicsGlobal regulatory effects
Phenotypic analysesBiofilm formation, antibiotic resistance, virulencePhysiological outcomes

For S. epidermidis specifically, researchers would need to adapt these approaches from established protocols for other Staphylococcal species, taking into account species-specific characteristics such as biofilm formation capacity and methicillin resistance patterns .

How can researchers develop walK-targeted antimicrobial strategies?

The essential nature of the walK/walR system in Gram-positive bacteria makes it a promising antimicrobial target:

Target ApproachRationaleExperimental Methods
WalK autokinase inhibitorsBlock initial phosphorylationHigh-throughput screening with recombinant protein
WalK-WalR interaction disruptorsTarget W-Acidic motif interactionsFragment-based drug discovery, peptide mimetics
WalK phosphatase inhibitorsDysregulate signaling terminationStructure-based drug design
Allosteric modulatorsAlter protein conformationMolecular dynamics simulations

Drug development would proceed through stages:

  • In vitro screening with purified proteins

  • Cell-based assays to confirm membrane penetration and target engagement

  • Assessment of species selectivity

  • Evaluation of resistance development potential

  • In vivo efficacy and toxicity studies

The high conservation of this system across Gram-positive pathogens offers the potential for broad-spectrum activity, though selective targeting may require exploitation of species-specific features .

What methods are used to quantify the impact of walK mutations on biofilm formation?

Biofilm formation is a key virulence factor in S. epidermidis infections, particularly in medical device-associated infections. Several complementary methods are used to assess how walK mutations affect biofilm development:

MethodMeasurementAdvantagesLimitations
Crystal violet assayTotal biofilm biomassSimple, quantitative, high-throughputNon-specific (doesn't distinguish cells from matrix)
Confocal laser scanning microscopy3D biofilm architectureDetailed structural information, can use multiple fluorescent markersExpensive equipment, semi-quantitative
Scanning electron microscopySurface morphologyHigh-resolution images of cell-surface interactionsSample preparation can alter biofilm structure
Fluorescent reporter strainsGene expression in biofilmsReal-time monitoring of specific genesRequires genetic modification
Transcriptomics/proteomicsGlobal expression changesComprehensive view of regulatory networksComplex data analysis

The connection between walK mutations and biofilm phenotypes would be assessed by comparing wild-type strains with specific walK mutants (e.g., W-Acidic motif mutations) under standardized biofilm growth conditions. Research in S. mutans has shown that ΔTail mutants exhibit altered expression of numerous adhesion proteins and glucan-binding proteins that would likely impact biofilm formation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.