Recombinant Staphylococcus epidermidis Serine protease htrA-like (SE_0722/SE_0723)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is defined during production. If you require a particular tag, please specify this in your order; we will prioritize fulfilling this request.
Synonyms
SE_0722/SE_0723; Serine protease HtrA-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 12228)
Target Names
SE_0722/SE_0723
Target Protein Sequence
MDNNKKQVIPRSQYRRKRREYFHNVEREERIRREKIEKENQAKREQHQTKVNEERVKDNL RKARIEKLTQEEIHQQRDDKSYKQKTLNQNNQMNKSKDDDNKIGEESLHDVRVSSDTSTL PHQNKSIKDYDDSGNESKQHTKLTSKESMLGVNSNHTEQDSRSTQPYSSKHSYSQPKDKD NDNTQQAQFLKKEDKQRNRAENIKKVNEFKQLVVAFFKEHWPKMLIIIGIIVLLLILNAI FTTVNKNDHTNDSAFNGTAKDETTAMKIAENSVKSVVTVENDLSNDTTVSDNKNESDNEI GSGVVYKKVGDSIYIFTNAHVVGDQEKQKVTYGNDKSVTGKVIGKDKWSDLAVVKAKVAD ENIKPMTMGDSNNIKLAEPILVIGNPLGTDFKGSVSQGIVSGLNRHVPVDIDKNDNYDAL MKAFQIDAPVNPGNSGGAVVDRDGRLIGIVSLKIDMHNVEGMAFAIPINDVRKIAKELEH KGKVNYPNTEIKIKNVGDLDDSERNAINLPAKVNHGVLIGEVKENGLGDKAGLKKGDVIV ELDGKKIEDNLRYRQVIYSHYDDQKTITAKIYRNGAEKNIKIKLK
Uniprot No.

Target Background

Database Links

KEGG: sep:SE0722

STRING: 176280.SE0722

Protein Families
Peptidase S1C family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural and functional significance of HtrA-like serine proteases in Staphylococcus epidermidis?

HtrA-like serine proteases in S. epidermidis, including SE_0722 and SE_0723, are part of a highly conserved protease family found across bacteria, yeasts, plants, and humans. These proteases typically serve as quality control enzymes that degrade misfolded or damaged proteins, particularly during stress conditions. Their structure includes a serine protease domain containing the catalytic triad (Ser, His, and Asp) that mediates proteolytic activity .

The serine residue is located in the C-terminal domain and provides catalytic function, while His and Asp residues in the N-terminal domain ensure structural stability and functional activity . In related species like S. aureus, HtrA-like proteases contribute to stress resistance, bacterial survival, and virulence through their involvement in degrading abnormal proteins and potentially processing virulence factors .

To investigate SE_0722/SE_0723 function, researchers should employ:

  • Gene knockout studies with complementation experiments

  • Growth assays under various stress conditions (thermal, oxidative, antibiotic)

  • Proteomics approaches to identify substrate proteins

  • Structural analyses to determine domain organization and oligomeric state

How do HtrA-like proteases contribute to bacterial stress response mechanisms?

HtrA-like proteases function as critical components of bacterial stress response systems by degrading misfolded or damaged proteins that accumulate during adverse conditions. In Escherichia coli, HtrA (DegP) degrades periplasmic abnormal proteins during thermal or oxidative stress and exhibits chaperone activity at low temperatures .

In Staphylococcus aureus, inactivation of htrA1 results in sensitivity to puromycin-induced stress, demonstrating its role in stress tolerance . The functional conservation of HtrA-like proteases across bacterial species suggests SE_0722/SE_0723 likely serve similar protective functions in S. epidermidis.

Methodologically, researchers should:

  • Construct single and double knockout strains of SE_0722 and SE_0723

  • Subject wild-type and mutant strains to various stress conditions (temperature, oxidative agents, antibiotics)

  • Monitor growth rates, survival percentages, and protein aggregation levels

  • Measure proteolytic activity using fluorogenic substrates under different stress conditions

  • Perform transcriptomic analysis to identify stress-responsive gene networks affected by protease deletion

What experimental approaches are recommended for purifying active recombinant SE_0722/SE_0723?

Obtaining pure, active recombinant SE_0722/SE_0723 requires careful consideration of expression systems and purification strategies:

  • Expression system selection:

    • E. coli systems (BL21, Rosetta) for high yield but potential inclusion body formation

    • Insect cell systems for improved folding of complex proteins

    • Cell-free systems for potentially toxic proteins

  • Expression construct design:

    • Include purification tags (His6, GST) with TEV protease cleavage sites

    • Consider fusion partners to enhance solubility (MBP, SUMO)

    • Create catalytic mutants (S→A) as negative controls

  • Purification protocol:

    • Initial capture using affinity chromatography

    • Secondary purification via ion exchange or size exclusion chromatography

    • Tag removal followed by final polishing step

  • Activity verification:

    • Use fluorogenic peptide substrates (MeO-Succinyl-Ala-Ala-Pro-Val-NHMec for elastase-like activity or Z-Gly-Gly-Arg-NHMec for trypsin-like activity)

    • Confirm inhibition by serine protease inhibitors

    • Validate structure using circular dichroism or thermal shift assays

For optimal activity, determine the ideal buffer conditions by systematically testing pH ranges (5.0-9.0), salt concentrations (0-500 mM NaCl), and potential cofactors (divalent cations like Ca²⁺, Mg²⁺).

How can researchers investigate the activation mechanism of SE_0722/SE_0723?

Investigating the activation mechanism of SE_0722/SE_0723 requires a multifaceted approach combining computational methods, structural biology, and biochemical assays:

  • Molecular dynamics simulations:

    • Identify potential intermediate conformational states during activation

    • Detect concerted motions and inter-monomer communication pathways

    • Construct hidden Markov models to predict activation cascades

  • Site-directed mutagenesis:

    • Target residues in loops potentially involved in allosteric activation

    • Focus on highly conserved residues like arginine in loop L3 that might interact with adjacent monomers

    • Create double mutants to substantially modify loop dynamics

  • In vitro catalytic assays:

    • Compare activity of wild-type and mutant proteins

    • Determine kinetic parameters (Kcat, Km) under various conditions

    • Assess the impact of oligomerization state on activity

  • Structural studies:

    • Use X-ray crystallography or cryo-EM to capture different conformational states

    • Employ hydrogen-deuterium exchange mass spectrometry to detect dynamic regions

Recent research on HtrA1 revealed an allosteric mechanism where monomers relay activation signals to each other within the trimeric structure . The R302A mutation in loop L3 abolished HtrA1 activity by disrupting inter-monomer communication, suggesting a similar mechanism might exist in SE_0722/SE_0723 .

What approaches are effective for resolving contradictory data when studying SE_0722/SE_0723 functions?

When encountering contradictory results in SE_0722/SE_0723 research, implement a systematic troubleshooting process:

  • Experimental conditions assessment:

    • Compare precise conditions (temperature, pH, buffer composition)

    • Evaluate protein quality metrics (purity, aggregation state, activity)

    • Consider the impact of expression tags and purification methods

  • Technical validation:

    • Increase biological and technical replicates

    • Use alternative methodologies to measure the same parameter

    • Implement appropriate statistical analyses (ANOVA, regression analysis)

  • Biological context evaluation:

    • Test multiple S. epidermidis strains to identify strain-specific effects

    • Assess growth phase dependencies

    • Consider compensatory mechanisms in knockout strains through transcriptomics

  • Hypothesis refinement:

    • Develop models that accommodate seemingly conflicting observations

    • Design critical experiments to distinguish between competing hypotheses

    • Consider condition-specific effects (stress response may differ under various stressors)

  • Collaborative validation:

    • Engage independent laboratories to replicate key findings

    • Compare with published data on homologous proteins in related organisms

When reporting contradictory results, present all data transparently and discuss potential explanations for discrepancies based on experimental evidence and theoretical frameworks from the literature on bacterial serine proteases .

How can researchers differentiate the specific roles of SE_0722 versus SE_0723?

Distinguishing the specific functions of SE_0722 and SE_0723 presents a significant challenge due to potential functional redundancy, similar to what has been observed with HtrA1 and HtrA2 in S. aureus . To effectively differentiate their roles:

  • Genetic approaches:

    • Generate single and double knockout mutants

    • Create strains with inducible expression of each protease

    • Perform complementation studies with each gene individually

    • Generate chimeric proteins swapping domains between SE_0722 and SE_0723

  • Expression analysis:

    • Monitor transcription patterns under different stress conditions

    • Determine if expression is growth phase-dependent

    • Identify potential regulators controlling differential expression

  • Biochemical characterization:

    • Compare substrate specificity profiles using peptide libraries

    • Determine kinetic parameters for various substrates

    • Assess oligomerization states and structural differences

    • Develop protease-specific inhibitors or activity-based probes

  • Phenotypic analysis:

    • Compare stress resistance profiles of single mutants

    • Evaluate biofilm formation capacity

    • Assess virulence in infection models

    • Examine cell morphology and ultrastructure

  • Protein interaction studies:

    • Identify unique binding partners through pull-down experiments

    • Determine subcellular localization patterns

    • Assess potential interactions between SE_0722 and SE_0723

In S. aureus, HtrA1 inactivation resulted in sensitivity to puromycin-induced stress, while the double mutant showed altered expression of secreted virulence factors regulated by the agr system . Similar differential phenotypes might help distinguish SE_0722 and SE_0723 functions.

What is the optimal experimental design for characterizing the substrate specificity of SE_0722/SE_0723?

Characterizing substrate specificity requires a methodical experimental design that progresses from broad screening to detailed analysis:

  • Initial screening approaches:

    • Test general protease substrates (casein, gelatin) using zymography

    • Screen fluorogenic/chromogenic peptide substrates with different P1 residues

    • Assess cleavage of known substrates of other HtrA-like proteases

  • Positional scanning libraries:

    • Use combinatorial peptide libraries to determine preferred residues at each position

    • Design consensus sequences based on screening results

    • Synthesize optimized fluorogenic substrates for kinetic analysis

  • Proteomic identification of substrates:

    • Compare secretomes of wild-type and protease-deficient strains

    • Use terminal amine isotopic labeling of substrates (TAILS) to identify cleavage sites

    • Perform in vitro digestion of S. epidermidis lysates followed by mass spectrometry

  • Validation of individual substrates:

    • Express recombinant candidate substrates

    • Perform in vitro cleavage assays with purified SE_0722/SE_0723

    • Confirm cleavage sites by Edman degradation or mass spectrometry

    • Assess biological significance through mutagenesis of cleavage sites

  • Quantitative kinetic analysis:

    • Determine kinetic parameters (kcat, Km) for validated substrates

    • Compare efficiency ratios (kcat/Km) to establish preference hierarchies

    • Assess the impact of surrounding sequences on cleavage efficiency

Table 1: Experimental design for substrate specificity determination of SE_0722/SE_0723

StageMethodologyExpected OutcomeControls
Broad screeningZymography, fluorogenic substratesGeneral substrate class preferenceCatalytic mutant, buffer control
Positional scanningCombinatorial peptide librariesPreferred residues at each positionKnown serine proteases (control)
ProteomicsTAILS, comparative secretomicsCandidate physiological substratesWild-type vs. knockout comparison
ValidationIn vitro cleavage assaysConfirmed direct substratesNon-substrate proteins, heat-inactivated enzyme
Kinetic analysisSpectrofluorometric assaysQuantitative preference metricsMultiple substrate concentrations

How should researchers design experiments to investigate the role of SE_0722/SE_0723 in stress response?

To rigorously investigate the role of SE_0722/SE_0723 in stress response, design experiments that systematically evaluate multiple stressors and cellular responses:

  • Genetic construct preparation:

    • Generate single and double knockout mutants of SE_0722/SE_0723

    • Create complemented strains expressing wild-type or catalytically inactive variants

    • Construct reporter strains with stress-responsive promoters linked to fluorescent proteins

  • Stress exposure experiments:

    • Test temperature stress (heat shock, cold shock)

    • Apply oxidative stress (H₂O₂, paraquat)

    • Introduce membrane stress (detergents, antimicrobial peptides)

    • Challenge with antibiotics (cell wall inhibitors, protein synthesis inhibitors)

  • Survival and growth measurements:

    • Determine survival percentages after acute stress

    • Measure growth kinetics under chronic stress conditions

    • Assess long-term adaptation through serial passage experiments

    • Quantify colony-forming units at various time points post-stress

  • Molecular response analysis:

    • Monitor protease activity using activity-based probes

    • Quantify protein aggregation levels using aggregation-specific dyes

    • Measure expression of stress response genes via qRT-PCR

    • Profile global transcriptional responses using RNA-seq

  • Functional assays:

    • Assess membrane integrity using fluorescent dyes

    • Measure ATP levels as indicators of metabolic activity

    • Evaluate protein synthesis rates using puromycin incorporation

    • Monitor cell morphology changes via microscopy

When designing these experiments, follow the five key steps of experimental design: define variables, formulate specific hypotheses, design treatments to manipulate independent variables, assign subjects to appropriate groups, and plan dependent variable measurements .

Table 2: Comprehensive stress response experimental design for SE_0722/SE_0723 study

Stress TypeStress ConditionsMeasurementsTime PointsControls
Thermal45°C, 15°CGrowth rate, survival %, HSP expression0, 1, 3, 6, 24hWild-type, double knockout
Oxidative0.1-5 mM H₂O₂ROS levels, catalase activity, protein carbonylation15, 30, 60, 120 minCatalase-deficient strain
AntibioticSub-MIC concentrationsGrowth inhibition, membrane potential, protein synthesis0, 2, 4, 8, 24hAntibiotic-resistant strain
Osmotic0.5-2.0 M NaClCell volume, compatible solute production0, 30, 60, 180 minOsmoprotectant supplementation

What technologies are most effective for developing activity-based probes specific to SE_0722/SE_0723?

Developing activity-based probes (ABPs) specific to SE_0722/SE_0723 requires strategic design of multiple components:

  • Reactive warhead selection:

    • Diphenyl phosphonates are widely used for serine proteases due to their specificity and covalent binding properties

    • Monophenyl phosphinates may offer higher rates of irreversible inhibition for some serine proteases

    • Isocoumarins represent another effective chemotype for serine protease targeting

  • Peptide scaffold design:

    • Base the sequence on substrate specificity data for SE_0722/SE_0723

    • If specificity is unknown, adapt sequences from related HtrA proteases

    • Incorporate 3-4 amino acid positions (P4-P1) to confer specificity

  • Reporter group selection:

    • Biotin for pull-down and Western blot detection

    • Fluorophores (BODIPY, TAMRA) for direct visualization

    • Alkyne or azide handles for copper-catalyzed click chemistry applications

  • Optimization and validation:

    • Test probe library against recombinant SE_0722/SE_0723

    • Confirm specificity using catalytic mutants as negative controls

    • Validate selectivity in complex bacterial lysates

    • Perform competition assays with known inhibitors

  • Applications:

    • Monitor protease activation during stress responses

    • Identify conditions that affect active site accessibility

    • Discover protease inhibitors through competitive binding assays

    • Study protease localization in bacterial cells

The basic structure for an SE_0722/SE_0723-specific ABP could follow this template:
Peptide-diphenyl phosphonate-reporter

Where the peptide sequence is optimized based on substrate preferences, the diphenyl phosphonate serves as the reactive warhead, and the reporter enables detection and/or purification of labeled proteins .

Table 3: Design considerations for SE_0722/SE_0723 activity-based probes

ComponentOptionsSelection CriteriaExamples from Literature
Reactive groupDiphenyl phosphonate, monophenyl phosphinate, isocoumarinReactivity, stability, specificityABP1, ABP2, ABP7, ABP8
Peptide backboneBased on substrate specificitySelectivity for target proteaseQUBCL1, QUBTL1
ReporterBiotin, fluorophore, click handleDetection method compatibilityBiotinylated derivatives, ABP6 (azide)
DeliveryCell penetration tags, solubilizing groupsCellular accessibilityCell-permeable vs. non-permeable probes

What statistical approaches are recommended for analyzing SE_0722/SE_0723 activity data?

Analyzing SE_0722/SE_0723 activity data requires rigorous statistical methods tailored to the specific experimental design and data types:

  • Experimental design considerations:

    • Include sufficient technical (n≥3) and biological (n≥3) replicates

    • Incorporate appropriate positive and negative controls in each experiment

    • Use randomization and blinding where possible to minimize bias

  • Data preprocessing:

    • Test data for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Identify outliers using standardized methods (Grubbs' test, modified z-score)

    • Transform data if necessary to meet statistical assumptions (log, square root)

  • Activity comparison between variants:

    • For normally distributed data: t-test (two groups) or ANOVA (multiple groups)

    • For non-normal data: Mann-Whitney U (two groups) or Kruskal-Wallis (multiple groups)

    • For post-hoc analysis after ANOVA: Tukey's HSD or Dunnett's test

  • Enzyme kinetics analysis:

    • Use non-linear regression to fit enzyme kinetic models (Michaelis-Menten, allosteric)

    • Calculate confidence intervals for derived parameters (Km, Vmax, kcat/Km)

    • Compare models using Akaike Information Criterion or extra sum-of-squares F-test

  • Inhibitor studies:

    • Fit dose-response curves with four-parameter logistic model

    • Determine IC50 values with confidence intervals

    • Analyze mechanism of inhibition through global curve fitting

  • Reporting standards:

    • Report effect sizes and confidence intervals alongside p-values

    • Include sample sizes and specific statistical tests used

    • Present raw data points in figures (not just means and error bars)

Table 4: Statistical approaches for different types of SE_0722/SE_0723 experimental data

Data TypeStatistical ApproachKey ParametersSoftware Tools
Activity comparisonANOVA, post-hoc testsF statistic, p-value, effect sizeGraphPad Prism, R
Enzyme kineticsNon-linear regressionKm, Vmax, kcat, kcat/KmGraphPad Prism, R (drc package)
Inhibitor screeningIC50 determination, Z-factorIC50, Hill slope, Z'GraphPad Prism, TIBCO Spotfire
Stability assaysSurvival analysisHalf-life, rate constantsR (survival package)
Mutagenesis effectsMultiple comparison testsp-values with correctionR, Python (statsmodels)

How should researchers approach the functional characterization of mutant SE_0722/SE_0723 variants?

Functional characterization of SE_0722/SE_0723 mutants requires a comprehensive approach that assesses multiple aspects of protease activity:

  • Systematic mutation design:

    • Catalytic triad mutations (S→A, H→A, D→A) as negative controls

    • Substrate binding pocket mutations to alter specificity

    • Allosteric network mutations based on structural analysis

    • Loop mutations that may affect inter-monomer communication

    • Domain interface mutations to study domain interactions

  • Protein quality assessment:

    • Circular dichroism to confirm secondary structure integrity

    • Thermal shift assays to evaluate stability

    • Size exclusion chromatography to assess oligomerization state

    • Limited proteolysis to probe conformational differences

  • Activity characterization:

    • Determine kinetic parameters using fluorogenic substrates

    • Compare catalytic efficiency (kcat/Km) across mutants

    • Assess substrate specificity changes using diverse substrates

    • Evaluate pH and temperature optima shifts

  • Allosteric regulation analysis:

    • Test activation by substrate or peptide binding

    • Assess inter-monomer communication through mixed trimers

    • Evaluate inhibitor sensitivity differences

  • In vivo characterization:

    • Complement knockout strains with mutant variants

    • Assess restoration of stress tolerance

    • Evaluate impact on virulence-associated phenotypes

    • Monitor protein stability and expression in bacterial cells

For allosteric network mutants, consider variants similar to R302A in HtrA1, which abolished catalytic activity by disrupting inter-monomer communication through the L3 loop . The E306A/R310A double mutant showed a moderate reduction in activity, demonstrating that not all charged residues in loops are equally important .

Table 5: Comprehensive mutational analysis approach for SE_0722/SE_0723

Mutation TypeExample MutationsPurposeKey Assays
Catalytic triadS→A, H→A, D→ANegative controlsBasic activity assays
Substrate bindingVariations at S1 pocketAlter specificitySubstrate profile analysis
Allosteric networkConserved R in L3 loopDisrupt activationActivity assays, structural analysis
PDZ domainBinding pocket residuesAlter regulationSubstrate/ligand binding assays
Domain interfaceHinge region residuesModify flexibilityDomain movement analysis

How can researchers investigate the potential role of SE_0722/SE_0723 in S. epidermidis biofilm formation?

Biofilm formation is a critical virulence determinant for S. epidermidis, particularly in medical device-associated infections. To investigate SE_0722/SE_0723's role in this process:

  • Genetic approaches:

    • Generate single and double knockout mutants

    • Create complemented strains expressing wild-type or catalytically inactive variants

    • Develop inducible expression systems to control protease levels during biofilm formation

  • Static biofilm assays:

    • Quantify biomass using crystal violet staining

    • Measure metabolic activity with tetrazolium dyes

    • Evaluate extracellular DNA content

    • Assess protein and polysaccharide components

  • Dynamic biofilm studies:

    • Use flow cell systems to monitor biofilm development in real-time

    • Measure biofilm thickness, density, and architecture

    • Assess mechanical properties and resistance to shear forces

    • Evaluate dispersal under various conditions

  • Matrix composition analysis:

    • Extract and characterize matrix components

    • Identify processed proteins within biofilm matrix

    • Determine if specific substrates are cleaved during biofilm formation

    • Use activity-based probes to monitor protease activity within biofilms

  • Host interaction studies:

    • Evaluate adhesion to relevant host proteins

    • Assess biofilm formation on medical-grade materials

    • Investigate immune response to wild-type versus protease-deficient biofilms

The differential expression of SE_0722/SE_0723 during biofilm versus planktonic growth should be carefully investigated, as altered expression patterns may indicate specific roles during different growth modes. If HtrA-like proteases in S. epidermidis function similarly to those in S. aureus, they may contribute to stress resistance during biofilm formation and potentially process secreted factors involved in biofilm development .

What are the best approaches for developing specific inhibitors targeting SE_0722/SE_0723?

Developing specific inhibitors for SE_0722/SE_0723 requires a structured drug discovery approach:

  • Target validation:

    • Confirm that inhibiting SE_0722/SE_0723 produces desirable phenotypes

    • Determine if both proteases need to be inhibited or if specific targeting is preferable

    • Assess potential off-target effects on host proteases

  • Virtual screening:

    • Generate homology models if crystal structures are unavailable

    • Perform molecular docking with virtual compound libraries

    • Prioritize compounds based on predicted binding energy and interactions

  • Initial screening:

    • Test general serine protease inhibitors (PMSF, 3,4-dichloroisocoumarin)

    • Screen peptide-based inhibitors derived from substrate preferences

    • Evaluate natural product libraries for novel scaffolds

  • Structure-activity relationship studies:

    • Synthesize analogs of hit compounds

    • Optimize for potency, selectivity, and physicochemical properties

    • Develop quantitative structure-activity relationship (QSAR) models

  • Characterization of lead compounds:

    • Determine inhibition mechanism (competitive, non-competitive)

    • Measure binding kinetics using surface plasmon resonance

    • Assess selectivity against other serine proteases

    • Test cellular activity and toxicity

For serine proteases, peptidyl di-aryl phosphonates represent an important chemotype with proven efficacy . Compounds like ABP3 and ABP4 have been developed as selective inhibitors for other bacterial serine proteases and could serve as templates for SE_0722/SE_0723 inhibitors .

Table 6: Inhibitor development pathway for SE_0722/SE_0723

Development StageMethodologiesSuccess CriteriaTimeline Estimate
Initial screeningFluorogenic substrate assaysIC50 < 10 μM2-3 months
Hit validationDose-response, selectivityConfirmed mechanism, selectivity ratio >101-2 months
Lead optimizationMedicinal chemistry, QSARImproved potency, selectivity, properties6-12 months
In vitro validationStress response, biofilm assaysActivity in relevant biological contexts3-4 months
Ex vivo testingInfection modelsEfficacy in relevant models4-6 months

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.