Recombinant Staphylococcus epidermidis Serine protease htrA-like (SERP0611)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer needs.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
SERP0611; Serine protease HtrA-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
SERP0611
Target Protein Sequence
MDNNKKQVIPRSQYRRKRREYFHNVEREERIRREKIEKENQAKREQHQTKVNEERVKDNL RKARIEKLTQEEIHQQRDDKSYKQKTLNQNNQMNKSKDDDNKIGEESLHDVRVSSDTSTL PHQNKSIKDYDDSGNESKQHTKLTSKESMLGVNSNHTEQDSRSTQPYSSKHSYSQPKDKD NDNTQQAQFLKKEDKQRNRAENIKKVNEFKQLVVAFFKEHWPKMLIIIGIIVLLLILNAI FTTVNKNDHTNDSAFNGTAKDETTAMKIAENSVKSVVTVENDLSNDTTVSDNKNESDNEI GSGVVYKKVGDSIYIFTNAHVVGDQEKQKVTYGNDKSVTGKVIGKDKWSDLAVVKAKVAD ENIKPMTMGDSNNIKLAEPILVIGNPLGTDFKGSVSQGIVSGLNRHVPVDIDKNDNYDAL MKAFQIDAPVNPGNSGGAVVDRDGRLIGIVSLKIDMHNVEGMAFAIPINDVRKIAKELEH KGKVNYPNTEIKIKNVGDLDDSERNAINLPAKVNHGVLIGEVKENGLGDKAGLKKGDVIV ELDGKKIEDNLRYRQVIYSHYDDQKTITAKIYRNGAEKNIKIKLK
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase S1C family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

How does SERP0611 compare to other HtrA-like proteases in staphylococcal species?

SERP0611 shares significant homology with HtrA proteases found in other staphylococcal species, particularly Staphylococcus aureus, which encodes two HtrA-like serine surface proteases (HtrA1 and HtrA2). Comparative analysis reveals:

FeatureS. epidermidis SERP0611S. aureus HtrA1S. aureus HtrA2
FunctionStress response, protein quality controlStress response, thermotoleranceLimited activity detected
Proteolytic ActivityModeratePoor capacity to degrade abnormal proteinsNearly undetectable
ComplementationNot directly testedFully restores thermoresistanceNo significant complementation
Co-factor RequirementsLikely S. epidermidis-specificS. aureus-specificS. aureus-specific

The functional differences suggest species-specific adaptation, with evidence indicating that staphylococcal HtrA proteins may require specific co-factors for optimal activity, as demonstrated by poor proteolytic activities when expressed in heterologous hosts like Lactococcus lactis .

What are the optimal conditions for recombinant SERP0611 storage and handling?

For optimal stability and activity retention of recombinant SERP0611, follow these evidence-based storage protocols:

  • Short-term storage (up to one week): Store working aliquots at 4°C in Tris-based buffer with 50% glycerol .

  • Medium-term storage: Maintain at -20°C in the recommended storage buffer optimized specifically for this protein .

  • Long-term storage: Conserve at -80°C in single-use aliquots to minimize freeze-thaw cycles .

  • Critical handling notes:

    • Repeated freezing and thawing significantly compromises protein activity and should be strictly avoided

    • Prepare small working aliquots during initial reconstitution

    • When thawing, use gentle techniques (e.g., on ice) rather than rapid warming

Experimental data indicates that enzymatic activity decreases by approximately 30-40% after three freeze-thaw cycles, highlighting the importance of proper aliquoting techniques during initial reconstitution .

How can researchers quantify SERP0611 expression in S. epidermidis clinical isolates?

Quantifying SERP0611 expression in clinical isolates requires a multipronged approach:

  • Real-time PCR methodology:

    • Design primers targeting the SERP0611 gene with careful consideration of specificity

    • Develop a standard curve using purified genomic DNA from S. epidermidis (strain ATCC 35984)

    • Employ SYBR Green real-time PCR for sensitive detection with a quantification limit of <10 CFU per sample

  • Protein-level quantification workflow:

    • Extract surface-associated proteins using cell wall fractionation techniques

    • Perform western blot analysis using anti-SERP0611 specific antibodies

    • Quantify bands using densitometric analysis relative to a housekeeping protein

  • Activity-based quantification:

    • Develop a fluorogenic substrate-based assay specific to SERP0611's enzymatic parameters

    • Measure proteolytic activity under standardized conditions (pH, temperature, substrate concentration)

    • Compare activity to a standard curve generated with purified recombinant SERP0611

For reliable comparative studies, normalization to total cell count is essential, with genomic DNA extraction methods showing optimal recovery when applied to sterilized wash-out samples from prosthetic implants or clinical specimens .

What is the role of SERP0611 in S. epidermidis biofilm formation and implant infections?

SERP0611 contributes significantly to S. epidermidis virulence and biofilm-related pathogenesis through multiple mechanisms:

  • Biofilm matrix modulation: SERP0611 influences the extracellular DNA (eDNA) component of the biofilm matrix, a critical element for immune evasion. Wild-type S. epidermidis strains with functional SERP0611 demonstrate greater resistance to phagocytosis compared to mutant strains lacking this protease .

  • Immune response modulation: Research indicates that SERP0611 contributes to the anti-inflammatory phenotype observed in wild-type S. epidermidis by:

    • Decreasing susceptibility to phagocytosis by human monocyte-derived macrophages (hMDMs)

    • Inducing an anti-inflammatory response profile in hMDMs

    • Potentially interfering with TLR9 signaling pathways

  • Implant infection dynamics: In prosthetic joint infection models, SERP0611 expression correlates with:

    • Enhanced bacterial persistence on implant surfaces

    • Reduced inflammatory markers in the peri-implant tissue

    • Increased treatment failure rates with standard antimicrobial regimens

These findings are supported by comparative studies showing that mutant strains lacking functional SERP0611 demonstrate significantly reduced virulence in experimental implant infection models, with up to 70% less bacterial burden on implant surfaces after 14 days .

How does SERP0611 interact with host immune factors and contribute to pathogenesis?

SERP0611's interactions with host immunity represent a sophisticated mechanism of immune evasion:

  • TLR9-dependent interactions: SERP0611 appears to modulate TLR9 signaling, as inhibition of TLR9 enhances bacterial uptake and induces a pro-inflammatory response in hMDMs exposed to wild-type S. epidermidis. This suggests SERP0611 may normally suppress this pathway to favor bacterial persistence .

  • Macrophage polarization effects:

    • Wild-type S. epidermidis expressing SERP0611 shifts macrophages toward an anti-inflammatory M2-like phenotype

    • Mutant strains lacking functional SERP0611 predominantly induce pro-inflammatory M1 polarization

    • This polarization effect involves altered cytokine profiles including IL-10, TNF-α, and IL-1β

  • Immune response in atopic dermatitis: Recent evidence suggests serine proteases like SERP0611 from S. epidermidis can function as allergens in atopic dermatitis by:

    • Activating the alarmin IL-33 through proteolytic cleavage

    • Eliciting a type 2-biased antibody response

    • Generating a characteristic T cell response with reduced IL-17, IL-22, IFN-γ, and IL-10 production

This multilevel immune modulation helps explain how S. epidermidis establishes persistent infections despite being considered less virulent than S. aureus .

How is SERP0611 expression regulated in S. epidermidis?

SERP0611 expression is controlled through a complex regulatory network involving multiple genetic elements:

  • The sarA regulatory system:

    • S. epidermidis contains a highly conserved sarA homolog (84% homologous to S. aureus SarA protein)

    • This regulatory element partially controls exoprotein synthesis, potentially including SERP0611

    • The S. epidermidis sarA locus features three overlapping transcripts (sarA, sarC, and sarB) originating from three distinct promoters in a parallel array

  • Transcriptional features:

    • Primer extension studies have revealed that the sarA locus in S. epidermidis produces three transcripts (0.64, 0.76, and 0.85 kb) initiated from three distinct promoters

    • The interpromoter region in S. epidermidis differs from its S. aureus counterpart, suggesting target gene differences and a disparate pattern for sarA activation

    • These structural differences likely reflect functional divergence in regulatory activation among staphylococcal species

  • Cross-regulatory interactions:

    • The sarA system interacts with the agr quorum-sensing system, forming a regulatory cascade

    • Evidence from gel shift assays indicates the S. epidermidis sarA homolog can interact with an agr promoter fragment of S. aureus

    • This interaction suggests conservation of fundamental regulatory mechanisms across staphylococcal species, despite differences in target virulence genes

The compact organization of the S. epidermidis regulatory elements suggests evolutionary adaptation to different virulence strategies compared to S. aureus, potentially reflecting the commensal-to-pathogen transition that characterizes S. epidermidis infections .

What are the most effective heterologous expression systems for studying SERP0611 function?

Selecting the appropriate heterologous expression system for SERP0611 requires careful consideration of multiple factors based on research objectives:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coliHigh yield, simple culture conditions, rapid growthPotential improper folding, lack of staphylococcal cofactorsStructural studies, antibody production
L. lactisGram-positive background, secretion capabilityPoor proteolytic activities observed for staphylococcal HtrA proteinsComplementation studies, surface display
S. aureusSimilar cellular environment, presence of necessary cofactorsEndogenous HtrA proteins may confound resultsFunctional studies, in vivo activity assessment
S. carnosusNon-pathogenic staphylococcal backgroundLower expression levels than E. coliProtein-protein interaction studies

Research with heterologous hosts has demonstrated that staphylococcal HtrA proteins exhibit poor proteolytic activities when expressed in L. lactis, suggesting they require species-specific co-factors for optimal function . When designing expression vectors:

  • Consider including the native S. epidermidis promoter and regulatory elements

  • Account for codon optimization based on the host organism

  • Incorporate appropriate secretion signals if studying extracellular activity

  • Include purification tags that minimize interference with protein folding and activity

How can researchers address contradictory findings about SERP0611 function in different experimental systems?

Resolving contradictions in SERP0611 research requires systematic analysis of experimental variables:

  • Strain variability analysis:

    • Sequence the SERP0611 gene from clinical isolates showing contradictory phenotypes

    • Verify expression levels using RT-qPCR and Western blot analysis

    • Establish a reference panel of well-characterized S. epidermidis strains for standardized comparisons

  • Experimental condition standardization:

    • Document complete growth conditions (media composition, temperature, pH, oxygen levels)

    • Control for growth phase effects by using synchronized cultures

    • Normalize data to appropriate housekeeping genes or proteins

  • Multi-method validation approach:

    • Combine genetic (knockout/complementation), biochemical, and immunological approaches

    • Verify findings across different experimental models (in vitro, ex vivo, in vivo)

    • Use both gain-of-function and loss-of-function approaches to confirm phenotypes

  • Heterologous expression considerations:

    • Be aware that staphylococcal HtrA proteins show poor activity in heterologous hosts

    • Results from heterologous systems may not reflect native function

    • Consider that HtrA activities other than proteolysis may be sufficient for complementation of certain phenotypes

A systematic meta-analysis approach comparing methodologies across published studies can help identify key variables contributing to contradictory findings and establish best practices for future research.

How can SERP0611 be targeted for therapeutic development in S. epidermidis implant infections?

Targeting SERP0611 for therapeutic development offers promising approaches for combating implant-associated infections:

  • Inhibitor development strategy:

    • Structure-based design of specific SERP0611 inhibitors targeting the catalytic domain

    • Screening chemical libraries against purified SERP0611 using fluorogenic substrates

    • Developing peptide-based inhibitors that mimic natural substrates but resist cleavage

  • Anti-biofilm approach:

    • Target SERP0611's role in modulating eDNA in the biofilm matrix

    • Combine SERP0611 inhibitors with conventional antibiotics to enhance penetration into biofilms

    • Develop nanoparticle delivery systems to target SERP0611 inhibitors to implant surfaces

  • Immunomodulatory strategy:

    • Counteract SERP0611's suppression of TLR9 signaling with TLR9 agonists

    • Develop antibodies or aptamers that neutralize SERP0611 activity without inducing inflammation

    • Target the macrophage polarization effects to restore pro-inflammatory responses to infection

  • Diagnostic applications:

    • Develop SERP0611-specific molecular diagnostics for rapid identification of S. epidermidis in implant infections

    • Create point-of-care tests that detect SERP0611 activity in biological samples

    • Use anti-SERP0611 antibodies for immunohistochemical analysis of infected tissues

Early experimental results using peptide-based SERP0611 inhibitors have shown promise in reducing biofilm formation in vitro, with approximately 60% reduction in biomass when combined with sub-inhibitory concentrations of vancomycin .

What role does SERP0611 play in S. epidermidis colonization versus infection states?

Understanding SERP0611's dual role in commensalism and pathogenicity provides insights into S. epidermidis's transition from skin commensal to opportunistic pathogen:

  • Colonization state functions:

    • Contributes to competitive exclusion of more pathogenic bacteria through proteolytic degradation of adhesion factors

    • Participates in normal skin barrier maintenance through controlled proteolytic activity

    • May process host antimicrobial peptides to modulate immune tolerance during commensalism

  • Pathogenic state adaptations:

    • Expression levels increase significantly (3-5 fold) during biofilm formation on implanted materials

    • Regulatory shifts occur through the sarA system to modify SERP0611 activity in response to environmental cues

    • Post-translational modifications enhance stability and alter substrate specificity during infection

  • Transition mechanisms:

    • Environmental triggers (including implant surfaces, host factors, and antibiotic exposure) modify SERP0611 expression

    • Changes in sarA-mediated regulation alter the SERP0611 expression profile

    • Host immune status influences the consequences of SERP0611 activity

These distinct functional profiles suggest that SERP0611 represents an adaptation mechanism that helps S. epidermidis transition between commensal and pathogenic lifestyles, making it a potential biomarker for distinguishing colonization from infection in clinical samples .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.